Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03910-AT5G18170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamate dehydrogenase 3
Function (paralog2):glutamate dehydrogenase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9260284776962
Log2 mRNA fold difference:2.9323923041381
Log2 TE fold difference:-0.4053068464111
Sequences
Protein sequence

MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN
ARGPMKGGIRYHPEVEPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSLSELERL
TRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
RDAATGRGVLFATEALLNEHGKTISGQRFAIQGFGNVGSWAAKLISDKGGKIVAVSDVTG
AIKNNNGIDILSLLEHAEENRGIKGFDGADSIDPDSILVEDCDILVPAALGGVINRENAN
EIKAKFIIEGANHPTDPEADEILKKKGVMILPDIYANSGGVTVSYFEWVQNIQGFMWDEE
KVNRELKTYMTRGFKDLKEMCQTHSCDLRMGAFTLGINRVAQATTIRGWGS

MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSKLSISELERL
TRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLG
RDAATGRGVMFGTEALLNEHGKTISGQRFVIQGFGNVGSWAAKLISEKGGKIVAVSDITG
AIKNKDGIDIPALLKHTKEHRGVKGFDGADPIDPNSILVEDCDILVPAALGGVINRENAN
EIKAKFIIEAANHPTDPDADEILSKKGVVILPDIYANSGGVTVSYFEWVQNIQGFMWEEE
KVNDELKTYMTRSFKDLKEMCKTHSCDLRMGAFTLGVNRVAQATILRGWGA

Other information
Ka divergence:-0.268695KaKs divergence:0.623509
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1236Length 2 (bp):1236Length divergence:0
MFE 1 (kcal):-371.64MFE 2 (kcal):-403.58MFE divergence0.041