Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03920-AT5G18180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):H/ACA ribonucleoprotein complex, subunit Gar1/Naf1 protein
Function (paralog2):H/ACA ribonucleoprotein complex, subunit Gar1/Naf1 protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-5.9456333426156
Log2 mRNA fold difference:-4.923808069638
Log2 TE fold difference:-1.0537967730471
Sequences
Protein sequence

MRPPMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGPPSEVVE
VATFVHACEGDAVTKLSQEKIPHFNAPIYLENKTQIGKVDEIFGPINESLFSIKMMEGIV
ATSYSPGDKFFIDPYKLLPLARFLPQPKGQSTGGRGGAGRGRGDSRGRGRGGSFSRGRGA
PRGGRFPPRGGSRGSFRGRGRF

MRPPRGGGSFRGRGGRDNGGRGRGRGRGRGRFGGGNYDEGPPSEVVEVATFLHACEGDAV
FKLSNVKIPHFNAPIYLQNKTQIGRVDEIFGPINESLFSIKMREGIVATSYSQGDKFFIS
PEKLLPLSRFLPQPKGQSGGRGEGRVPPRGRGPPRGRGNFRGRGAPRGASRGFQPRGGPR
GGFRGRGRA

www.000webhost.com

Other information
Ka divergence:0.289284KaKs divergence:-0.0916828
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):609Length 2 (bp):570Length divergence:-0.033
MFE 1 (kcal):-207.2MFE 2 (kcal):-190.3MFE divergence-0.043