Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03930-AT3G03940
Species:Arabidopsis
Duplication type:TD
Function (paralog1):protein kinase-related
Function (paralog2):Protein kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.16947621883
Log2 mRNA fold difference:3.6067515967345
Log2 TE fold difference:-0.49127642498795
Sequences
Protein sequence

MRPPISSGRIGDGGLDSCPEKKEEEKDSTSRLCSDLSDLRIERIGSTPAFQWISVYTKRP
PMKQRFHHNIANSRLSHHAEKGKRDGLFISCVASEANLWALVMDAGTGFTSQVYKFSSTF
LPKDWIMKQWEKNYYISSIAGANNGSSLVVMSKGTRYIQQSYKTGDSIPLKWMDKKWKEG
FHVTSMTTGGSRWGVVMSRNSGFSEQVMEVDFLNPSEDINRRLESGYMITSMAATADQAA
LILSIPRRKITDEIQETLRTSSFPSSYVKDKWGKNMFITSICYGRTV

MPELRSGARRSRRLDEQPNPPLVEQAENIVLPPQTATRRRGGGRGRGNAALAKGAAPPRP
TAAGRGRGIRLTDLEPEPCEVRPAAGAIGATEPALNRVEGVADKDIAAEGGSAEKVVGME
EDSSMGPVPERVQVGNSPVYKTERKLGKGGFGQVYVGRRVSGGSDRIGADAIEVALKLEH
RNSKGCNFGPPYEWQVYNTLNSCYGIPAVHHKGRQGDFYILVMDMLGPSLWDVWNSLAQS
MSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWK
DSHSGQHVEYDQRPDVFRGTIRYASCHAHLGRTGSRRDDLESLAYTLIFLMRGRLPWQGY
QGDNKSFLVCKKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNYAKLISIFDTLIEP
CAISRPIRIDGALKVGQKRGRLLINLEEDEQPRKKIRIGSPATQWISVYNARRPMKQRYH
YNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM
EQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMT
TAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPK
RKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC

www.000webhost.com

Other information
Ka divergence:-0.839266KaKs divergence:-0.768273
GC content 1 (%):41GC content 2 (%):45GC content divergence:0.047
Length 1 (bp):864Length 2 (bp):2106Length divergence:0.418
MFE 1 (kcal):-231.96MFE 2 (kcal):-654.71MFE divergence0.477