Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03930-AT5G18190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein kinase-related
Function (paralog2):Protein kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.9622407682079
Log2 mRNA fold difference:3.3483732552933
Log2 TE fold difference:-0.44522750649638
Sequences
Protein sequence

MRPPISSGRIGDGGLDSCPEKKEEEKDSTSRLCSDLSDLRIERIGSTPAFQWISVYTKRP
PMKQRFHHNIANSRLSHHAEKGKRDGLFISCVASEANLWALVMDAGTGFTSQVYKFSSTF
LPKDWIMKQWEKNYYISSIAGANNGSSLVVMSKGTRYIQQSYKTGDSIPLKWMDKKWKEG
FHVTSMTTGGSRWGVVMSRNSGFSEQVMEVDFLNPSEDINRRLESGYMITSMAATADQAA
LILSIPRRKITDEIQETLRTSSFPSSYVKDKWGKNMFITSICYGRTV

MPELRSGARRLRQPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAKGAAPPRPAGGVGR
GRGIRLIDLEAEPCEVRPAVGEPAFNQVEAVAEKDIAMEGGSAEKVVGVEEDSSTAPVPE
RVQVGNSPVYKTERKLGKGGFGQVFVGRRVSGGSDRIGADAIEVALKFEHRNSKGCNFGP
PYEWQVYNTLNGCYGVPAVHHKGRQGDFYILVMDMLGPSLWDVWNSSGQSMSPNMVACIA
VESISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASKWKDSHSGQHVEY
DQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLLKGRLPWQGYQGDNKSFLVC
KKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNYAKLISIFDSLIEQCALSRPIKID
GALKVGQKRGRMLLNLDEDEQPKKKIRIGSPACQWISVYNARRPMKQRYHYNVADSRLHQ
HVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVFLHKDWIMEQWEKNYYIS
SIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVM
SRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQET
LRTTAFPSTHVKEKWAKNLYIASICFGRTVC

www.000webhost.com

Other information
Ka divergence:-0.666838KaKs divergence:-0.473876
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):864Length 2 (bp):2076Length divergence:0.412
MFE 1 (kcal):-231.96MFE 2 (kcal):-651.59MFE divergence0.475