Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03940-AT5G18190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase family protein
Function (paralog2):Protein kinase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.2386607531883
Log2 mRNA fold difference:0.085579209675505
Log2 TE fold difference:-0.31809246099823
Sequences
Protein sequence

MPELRSGARRSRRLDEQPNPPLVEQAENIVLPPQTATRRRGGGRGRGNAALAKGAAPPRP
TAAGRGRGIRLTDLEPEPCEVRPAAGAIGATEPALNRVEGVADKDIAAEGGSAEKVVGME
EDSSMGPVPERVQVGNSPVYKTERKLGKGGFGQVYVGRRVSGGSDRIGADAIEVALKLEH
RNSKGCNFGPPYEWQVYNTLNSCYGIPAVHHKGRQGDFYILVMDMLGPSLWDVWNSLAQS
MSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWK
DSHSGQHVEYDQRPDVFRGTIRYASCHAHLGRTGSRRDDLESLAYTLIFLMRGRLPWQGY
QGDNKSFLVCKKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNYAKLISIFDTLIEP
CAISRPIRIDGALKVGQKRGRLLINLEEDEQPRKKIRIGSPATQWISVYNARRPMKQRYH
YNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVFLHKDWIM
EQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMT
TAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPK
RKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC

MPELRSGARRLRQPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAKGAAPPRPAGGVGR
GRGIRLIDLEAEPCEVRPAVGEPAFNQVEAVAEKDIAMEGGSAEKVVGVEEDSSTAPVPE
RVQVGNSPVYKTERKLGKGGFGQVFVGRRVSGGSDRIGADAIEVALKFEHRNSKGCNFGP
PYEWQVYNTLNGCYGVPAVHHKGRQGDFYILVMDMLGPSLWDVWNSSGQSMSPNMVACIA
VESISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASKWKDSHSGQHVEY
DQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLLKGRLPWQGYQGDNKSFLVC
KKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNYAKLISIFDSLIEQCALSRPIKID
GALKVGQKRGRMLLNLDEDEQPKKKIRIGSPACQWISVYNARRPMKQRYHYNVADSRLHQ
HVQKGNEDGLLISCVASAANLWALIMDAGTGFTSQVYELSTVFLHKDWIMEQWEKNYYIS
SIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNRWGVVM
SRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMDETQET
LRTTAFPSTHVKEKWAKNLYIASICFGRTVC

www.000webhost.com

Other information
Ka divergence:0.268861KaKs divergence:0.234467
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2106Length 2 (bp):2076Length divergence:-0.007
MFE 1 (kcal):-654.71MFE 2 (kcal):-651.59MFE divergence-0.002