Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03980-AT5G18210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.2614656851518
Log2 mRNA fold difference:-3.0302210645327
Log2 TE fold difference:0.78382088743715
Sequences
Protein sequence

MSTHSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASE
INDFPVREEITGKGPRAIVVQANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYP
TIADTSVEDFDHTFSVNTKGAFLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAA
SKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGEA
KDVVPLVGFLAGDGGEWVNGQIIPVNGGYV

MASSVSSLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVINYTTRSTEADQVAAEINSSAG
TVPQPIAVVFLADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEF
DRIFKVNTRGSFLCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVK
ILAKELKGLGITANCVSPGPVATEMFFDGKSEETVMNIIERSPFGRLGETKDIASVVGFL
ASDGGFKLQFSGDTRISNILQCINNAKTTKKQNWKSS

www.000webhost.com

Other information
Ka divergence:0.303091KaKs divergence:0.275679
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):813Length 2 (bp):834Length divergence:0.013
MFE 1 (kcal):-277.82MFE 2 (kcal):-258.3MFE divergence-0.036