Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04010-AT5G18220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-Glycosyl hydrolases family 17 protein
Function (paralog2):O-Glycosyl hydrolases family 17 protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.9135164412054
Log2 mRNA fold difference:-4.512425197976
Log2 TE fold difference:-0.22930507279786
Sequences
Protein sequence

MNYRRKQSAITNSAVVFIIISAVCFLSGGVSGLGVNWGTMASHQLPPKTVVEMLKDNNIQ
KVKLFDADTNTMGALAGSGVEVMVAIPNDLLLAMGNYQRAKDWVQRNVSRFNFNNGVKIK
YVAVGNEPFLTAYNGSFINLTYPALFNIQTALNEAGVGDFTKATVPLNADVYNSPPDNQV
PSAGRFRSDIIQEMTQIVNFLAQNKAPFTVNIYPFLSLYLSSDFPFEYAFFDGQNTVNDN
GVIYTNVFDASFDTLLASLNALNHGNMEVIVGEVGWPTDGDKNANVPNAERFYSGLLPRL
ANNVGTPMRKGYIEVYLFGFIDEDAKSVAPGNFERHWGIFKFDGQPKFPVDFRGQGQKKF
LTGAQNVQYFLNQWCMFNPNGRGNMSRLGDNINYACSHSDCTALGYGSSCGNLDANGNAS
YAFNMYFQVQNQEAQACDFEGLATITTQNISQGQCNFPIQIGEPSSGHYDYSYGSMVRLC
LVMSGLVFLLI

MSNRRKQSTTAGIFLCITIVSLLSGDVSALGVNWGTMSTHQLPPKTVVQMLKDNNVKKVK
LFDADTNTMVALAGSGIEVMVAIPNDQLKAMGSYNRAKDWVRRNITRFNDDVKIKYVAVG
NEPFLTAYNGSFINLTYPALFNIQKALNEAGVGDFIKATVPLNADVYNSPLENPVPSAGS
FRQDIFEEMKLIVNFLAHNKAPFTVNIYPFLSLYLSSDFPFDYAFFNGQNTVSDNGVIYT
NVFDANFDTLLASLKALGHGDMTVIVGEVGWPTDGDKNANIPNAERFYTGLLPKLAANRG
TPMRPGYIEVYLFGFIDEDAKSIAPGNFERHWGIFKYDGQPKFPADLSGAGQKKILTGAQ
NVQYLRNQWCMFNPNALTFSNNTNQLGDNVNYACTFSDCTALGYGSSCGNLDEVGNASYA
FNMYFQVQNQKAEACDFEGLAIITTRNISREQCNFPIQIGDPTSGHSDHNHRFISFSLVS
MLLLFTAL

www.000webhost.com

Other information
Ka divergence:-0.0202819KaKs divergence:-0.12231
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1476Length 2 (bp):1467Length divergence:-0.003
MFE 1 (kcal):-462.8MFE 2 (kcal):-412.16MFE divergence-0.058