Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04030-AT5G18240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):myb-related protein 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.42425779393749
Log2 mRNA fold difference:0.36129215124672
Log2 TE fold difference:-0.98954620230563
Sequences
Protein sequence

MYYQNQHQGKNILSSSRMHITSERHPFLRGNSPGDSGLILSTDAKPRLKWTPDLHERFIE
AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMM
EEKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGK
YLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLCSQQM
QTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQRMELT
WTEGLRGNPYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHKSQHQQGNNEDHKLETRNR
KGMDSTTELDLNTHVENYCTTRTKQFDLNGFSWN

MYYHNQHQGKSILSSSRMPISSERHPFLRGNGTGDSGLILSTDAKPRLKWTPDLHERFVE
AVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANSSLNKTSVMTMV
EENPPEVDESHSESLSIGPQPSMNLPISDALQMQIEVQRRLHEQLEVQRHLQLRIEAQGK
YLQSILEKAQETLGRQNLGAAGIEATKAQLSELVSKVSADYPDSSFLEPKELQNLHHQQM
QKTYPPNSSLDSCLTSSEGTQKAPKMLDNRLGLRTYIGDSTSEQKEIMEEPFFHRMELTW
AEEESLRENHNRPYLSTMVNNAEPRISSSRRSPGRLSIGVGLHEHRGRSSNNSEYTEERF
NENNEDCKLETHTRTALDLNTHDENYGTTRPKQFDLNGFSWN

Other information
Ka divergence:0.124281KaKs divergence:-0.212623
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1185Length 2 (bp):1209Length divergence:0.01
MFE 1 (kcal):-308.87MFE 2 (kcal):-314.67MFE divergence0.009