Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04060-AT5G18270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAC domain containing protein 46
Function (paralog2):Arabidopsis NAC domain containing protein 87

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.1505799325875
Log2 mRNA fold difference:0.22300639087966
Log2 TE fold difference:0.96556100811372
Sequences
Protein sequence

MVEEGGVVVNQGGDQEVVDLPPGFRFHPTDEEIITHYLKEKVFNIRFTAAAIGQADLNKN
EPWDLPKIAKMGEKEFYFFCQRDRKYPTGMRTNRATVSGYWKATGKDKEIFRGKGCLVGM
KKTLVFYTGRAPKGEKTNWVMHEYRLDGKYSYHNLPKTARDEWVVCRVFHKNAPSTTITT
TKQLSRIDSLDNIDHLLDFSSLPPLIDPGFLGQPGPSFSGARQQHDLKPVLHHPTTAPVD
NTYLPTQALNFPYHSVHNSGSDFGYGAGSGNNNKGMIKLEHSLVSVSQETGLSSDVNTTA
TPEISSYPMMMNPAMMDGSKSACDGLDDLIFWEDLYTS

MAVVVEEGVVLNHGGEELVDLPPGFRFHPTDEEIITCYLKEKVLNSRFTAVAMGEADLNK
CEPWDLPKRAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGCLVG
MKKTLVFYRGRAPKGEKTNWVMHEYRLEGKYSYYNLPKSARDEWVVCRVFHKNNPSTTTQ
PMTRIPVEDFTRMDSLENIDHLLDFSSLPPLIDPSFMSQTEQPNFKPINPPTYDISSPIQ
PHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQSLVSVSQETCLSSDVNANMTTTTEV
SSGPVMKQEMGMMGMVNGSKSYEDLCDLRGDLWDF

www.000webhost.com

Other information
Ka divergence:-0.200192KaKs divergence:-0.0605075
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1017Length 2 (bp):1008Length divergence:-0.004
MFE 1 (kcal):-309.01MFE 2 (kcal):-301.6MFE divergence-0.012