Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04090-AT5G18290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):small and basic intrinsic protein 1A
Function (paralog2):Aquaporin-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-5.1098168997571
Log2 mRNA fold difference:-4.6885134856409
Log2 TE fold difference:-0.3980909113427
Sequences
Protein sequence

MMGVLKSAIGDMLMTFSWVVLSATFGIQTAAIISAGDFQAITWAPLVILTSLIFVYVSIF
TVIFGSASFNPTGSAAFYVAGVPGDTLFSLAIRLPAQAIGAAGGALAIMEFIPEKYKHMI
GGPSLQVDVHTGAIAETILSFGITFAVLLIILRGPRRLLAKTFLLALATISFVVAGSKYT
GPAMNPAIAFGWAYMYSSHNTWDHIYVYWISSFVGALSAALLFRSIFPPPRPQKKKQKKA

MSAVKSALGDMVITFLWVILSATFGIQTAAIVSAVGFHGITWAPLVISTLVVFVSISIFT
VIGNVLGGASFNPCGNAAFYTAGVSSDSLFSLAIRSPAQAIGAAGGAITIMEMIPEKYKT
RIGGKPSLQFGAHNGAISEVVLSFSVTFLVLLIILRGPRKLLAKTFLLALATVSVFVVGS
KFTRPFMNPAIAFGWAYIYKSHNTWDHFYVYWISSYTGAILSAMLFRIIFPAPPLVQKKQ
KKA

www.000webhost.com

Other information
Ka divergence:0.329819KaKs divergence:0.0198639
GC content 1 (%):48GC content 2 (%):44GC content divergence:-0.043
Length 1 (bp):723Length 2 (bp):732Length divergence:0.006
MFE 1 (kcal):-231.5MFE 2 (kcal):-221.21MFE divergence-0.023