Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04350-AT5G18490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF946)
Function (paralog2):Plant protein of unknown function (DUF946)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.10909373079671
Log2 mRNA fold difference:-0.092786296570318
Log2 TE fold difference:0.11790606762597
Sequences
Protein sequence

MFGCDCFYWSRGISELDSESSEPKPFSLPAPLPSWPQGKGFATGRISLGEIEVVKITKFH
RVWSSDSSHDKSKRATFYRADDIPEGFHCLGHYCQPTDQPLRGYVLAARTSKAVNADDFP
PLKKPVSYSLVWSADSEKNGGGYFWLPNPPVGYRAMGVIVTHEPGEPETEEVRCVREDLT
ESCETSEMILEVGSSKKSNGSSSPFSVWSTRPCERGMLSQGVAVGSFFCCTYDLSSERTV
PDIGCLKNLDPTLHAMPNLDQVHAVIEHFGPTVYFHPEEAYMPSSVQWFFKNGALLYRSG
KSEGQPINSTGSNLPAGGCNDMDFWIDLPEDEEAKSNLKKGNLESSELYVHVKPALGGTF
TDIVMWIFCPFNGPATLKIGLFTLPMTRIGEHVGDWEHFTFRICNFSGELWQMFFSQHSG
GGWVDASDIEFVKDNKPAVYSSKHGHASFPHPGMYLQGSSKLGIGVRNDVAKSKYIVDSS
QRYVIVAAEYLGKGAVIEPCWLQYMREWGPTIAYDSGSEINKIMNLLPLVVRFSIENIVD
LFPIALYGEEGPTGPKEKDNWEGDEMC

MFCDCFYWNKGFSELESESSESKPFSLPSPLPQWPQGRGFATGRISLGEIQVVKVTEFDR
VWKCGTSRGKLRCASFYKPVGIPEGFHCLGHYCQPNNQPLRGFVLAARANKPGHLADDHR
PPLKKPLNYSLVWSSDSDCYFWLPNPPVGYRAVGVIVTDGSEEPEVDEVRCVREDLTESC
ETGEKVLGVGSFNVWSTKPCERGIWSRGVEVGSFVCSTNDLSSDNKAAMNIACLKNLDPS
LQGMPNLDQVHALIHHYGPMVYFHPEETYMPSSVPWFFKNGALLHRFGKSQGEPINSAGS
NLPAGGENDGSFWIDLPEDEEVRSNLKKGNIESSELYVHVKPALGGIFTDVVMWIFCPFN
GPATLKIGLLTVPMNRLGEHVGDWEHFTFRISNFNGDLTQMFFSQHSGGGWVDVSDLEFV
KGSNKPVVYSSKHGHASFPHPGMYLQGPSKLGIGVRNDVAKSKYMVDSSQRYRIVAAEYL
GEGAVSEPYWLQFMREWGPTIVYDSAAEINKIIDLLPLILRNSFESLFPIELYGEEGPTG
PKEKDNWEGDEIC

www.000webhost.com

Other information
Ka divergence:0.156421KaKs divergence:0.199682
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1704Length 2 (bp):1662Length divergence:-0.012
MFE 1 (kcal):-553.8MFE 2 (kcal):-541.34MFE divergence-0.011