Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04550-AT5G28500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.56812349373622
Log2 mRNA fold difference:0.9437482857877
Log2 TE fold difference:-0.4005142973913
Sequences
Protein sequence

MFSLKSLISSPFTQSTTHGLFTNPITRPVNPLPRTVSFTVTASMIPKRSSANMIPKNPPA
RQQLYQPFRPPSSPIPTQFRSLDSAGKIEILAGRMALWFEYAPLISSLYTDGFTPPTIEE
LTGISSIEQNRLIVGAQVRDSILQSIHEPELISAFDTGGAELLYEIRLLSTTQRVAAATF
IIDRNIDSKGAQDLARAIKDYPNRRGDVGWLDFDYNLPGDCLSFLYYRQSRENKNPSDQR
TSMLLQALGVAESEKAKNRLNTELYGDKEAEKEKEKKKKEEEVKAIRIPVVRLKFGEVAE
ATSVVVLPVCKAEEGEKKILEAPMEIIAGGDFKVVEAEKGWKRWVVLPSWNPVAAIGKGG
VAVSFRDDRKVLPWDGKEEPLLVVADRVRNVVEADDGYYLVVAENGLKLEKGSDLKAREV
KESLGMVVLVVRPPREDDDDWQTSHQNWD

MLSLTATTLSSSIFTQSKTHGFFNTRPVYRKPFTTITSALIPASNRQAPPKQQLYQPFRP
PPSPIPPKFRSLDTAGKIEVLADRLGLWFEYAPLISSLYTEGFTPPSIEELTGISGVEQN
SLIVGAQVRDSLVQSGAKPELIAAFDTNGAELLYEIRLLNTTQRVAAAEYIVDHGFDTKG
AGDLARAIKDFPHRRGDVGLGDFDYNLPGDCLSFMLYRKSREHRSPSEIRTTLLEQALET
AVTEKAKKAVLRELHGESEEERVKEEEIKIIRVPVVRLRFGEVAGASSVVVLPVCKAEEG
EEKLLEAPMEFESGGEFGVVEAEKDWSRWVVLPGWDPVVAVRKGVAVSFSDDREVLPWNG
KGEAIMVVIDREKKTVEADNGYYYLVVADGGMKLDRGLVLKEKGVNESLGMVVLVVRPPR
DDDDEWQINDEDWD

www.000webhost.com

Other information
Ka divergence:-0.0105243KaKs divergence:-0.145239
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1350Length 2 (bp):1305Length divergence:-0.017
MFE 1 (kcal):-455.02MFE 2 (kcal):-421.22MFE divergence-0.039