Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04670-AT5G28650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 39
Function (paralog2):WRKY DNA-binding protein 74

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.1493639061245
Log2 mRNA fold difference:-5.6421192953881
Log2 TE fold difference:2.9855022176446
Sequences
Protein sequence

MEEVEAANRSAIESCHGVLNLLSQRTSDPKSLTVETGEVVSKFKRVASLLTRGLGHGKFR
STNKFRSSFPQHIFLESPICCGNDLSGDYTQVLAPEPLQMVPASAVYNEMEPKHQLGHPS
LMLSHKMCVDKSFLELKPPPFRAPYQLIHNHQQIAYSRSNSGVNLKFDGSGSSCYTPSVS
NGSRSFVSSLSMDASVTDYDRNSFHLTGLSRGSDQQHTRKMCSGSLKCGSRSKCHCSKKR
KLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVE
RCIDETSMLIVTYEGEHNHSRILSSQSAHT

MEEVEAANKAAVESCHGVLNLLSQQTNDSKSIMVETREAVCKFKRVSSLLSRGLGQRKIK
KLNNNNYKFSSSLLPQHMFLESPVCSNNAISGCIPILAPKPLQIVPAGPPPLMLFNQNMC
LDKSFLELKPPSSRAVDPKPYQFIHTHQQGVYSRSKSGLNLKFDGSIGASCYSPSISNGS
RSFVSSLSMDGSVTDYDRNSFHLIGLPQGSDHISQHSRRTSCSGSLKCGSKSKCHCSKKR
KLRVKRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVE
RCVEETSMLIVTYEGEHNHSRILSSQSAHT

www.000webhost.com

Other information
Ka divergence:-0.132272KaKs divergence:-0.411232
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):993Length 2 (bp):993Length divergence:0
MFE 1 (kcal):-284.39MFE 2 (kcal):-270.67MFE divergence-0.025