Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04830-AT5G28220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein prenylyltransferase superfamily protein
Function (paralog2):Protein prenylyltransferase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.078756139995
Log2 mRNA fold difference:-2.1273166561485
Log2 TE fold difference:0.032800796079669
Sequences
Protein sequence

MVTKTEEIQLNQLENQVENGGGGVWEYLCLVRKLKVRRSEIVLKHGLSILNDSGKRSALG
PDEWTLYEQVAIAAMDCQSLGVAQNCIKVLKKKFPESKRVGKLEALLLEAKGMWEEAEKA
YTSLLEDNPLDQVIHKRKVAMAKAQGKSSLAIEHLNKYLEVFMADHDAWRELAEIYVSLQ
MYKQAAFCYEELILTQPTLPLYHLAYADVLYTIGGLENLIAARKYYAATIDLTGGKSTRA
LLGICLCGSAIAQISKGRNKEDKDMAAPELQSLAATALEREYKQKAPAKLNLLTSALRNL
KIA

MLVSSSKITRAREMVTKTEEKQLNQLEIQVDNGGGGTWEYLCLVRNLKVRRSEKVLKHGS
SILNDQKKRSALGPDEWTLNEQVAIAAMDCQCLGVAQSCIKALQTKFPGSKRVGRLEALL
LEAKGLWGEAEEAYASLLEDNPLDQAIHKRRVAISKALGKPSIAIELLNKYLELFMADHD
AWRELAELYLSLQMYKQAAFCYEELILSQPTVPLYHLAYAEVLYTIGGVENIISARKYYA
ATVDLTGGKNTRALLGICLCASAIAQLSKGRNKEDKDATAAPELHSLAAAAVEKEYKQKA
PDKLQLISSALRILKT

www.000webhost.com

Other information
Ka divergence:0.364346KaKs divergence:0.562221
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):912Length 2 (bp):951Length divergence:0.021
MFE 1 (kcal):-292.8MFE 2 (kcal):-297.75MFE divergence0.008