Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04860-AT5G28150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF868)
Function (paralog2):Plant protein of unknown function (DUF868)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0283297462959
Log2 mRNA fold difference:1.2878655640142
Log2 TE fold difference:-0.1929921004086
Sequences
Protein sequence

MRDFPSCSGENGVQIADSSSSSSAGRNAQNLVICIYRCRIRGRTCLITVTWTKNLMGQCV
TVGVDDSCNRSLCKVEIKPWLFTKRKGSKTLEAYACNIDVFWDLSSAKFGSSPEPLGGFY
VGVVVDKEMVLLLGDMKKEAFKKTNAAPSSSLGAVFIAKKEHVFGKRTFATKAQFSGDGK
THDLVIECDTSLSDPCLIVRVDGKILMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFF
GLPSSPGNAVFMFRTCQSVEKTWSFTQVPTSSKSQSFGFSLILYAWKNE

MKDFPSCFGENGVQVADSSSSSNSGKNAQNLVTCIYQCRIRGRNCLITVTWTKNLMGQSV
TVGVDDSCNQSLCKVEIKPWLFTKRKGSKSLEAYSCNIDVFWDLSSAKFGSGPEALGGFY
VGVVVDKEMVLLLGDMKKEAFKKTNASPSSLGAVFIAKKEHVFGKRVFATKAQLFADGKF
HDLLIECDTNVTDPCLVVRVDGKTLLQVKRLKWKFRGNDTIVVNKMTVEVLWDVHSWLFG
LPTTGNAVFMFRTCQSTEKSLSFSQDVTTTNSKSHSFGFSLILYAWKSE

www.000webhost.com

Other information
Ka divergence:-0.174958KaKs divergence:-0.125315
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):870Length 2 (bp):870Length divergence:0
MFE 1 (kcal):-269.4MFE 2 (kcal):-255MFE divergence-0.027