Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04910-AT5G28080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):with no lysine (K) kinase 1
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.5662450253343
Log2 mRNA fold difference:-3.672484659703
Log2 TE fold difference:2.1306649495575
Sequences
Protein sequence

MNNLSYLEPDYSEFVEVDPTGRYGRYNEVLGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTELFTSGTLRQYRLRHK
RVNIRAMKHWCRQILRGLHYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFDYPYSECTHPAQIYKKVMS
GKKPDALYKVKDPEVKCFIEKCLATVSLRVSARELLDDPFLRIDDGEFDLRSVDMEDSVG
PLYRQPHHLPDYYNYPSNSSSLNRQYSNGNYPSNSSSLNRQYSNGYNSHHEYQNGWAYNP
AETEETHGIELFESRNNDDQEEEKKSGNVDITIKGKRRDDGGLFLRLRIADKEGRVRNIY
FPFDIETDTALSVATEMVAELDMDDHGVTKIANMIDGEISSLVPSWRPGPEFEECLAAAA
AANAASICNNCVSNRTSMGSVMDFLRTNPGANVIQCCRNGCGETHGRFEEITIRETEVRL
RELWKLQQQQESRELSSIDSGHNHSEEEEEEEVLYEDPENMFSCEAGNEINHISGSGSFS
FMPSKYCDEPSEKTENQVQQELRWLKAKCQIELRDIQDEQLKTRWPESGEEVEISPKDGF
LGSVSGLGREEDTVKEMFGERLVPKCLKRTTSLPVDAIDS

MMNNLSHLESDYSEYVEVDPTGRYGRYNEVLGKGSSKTVYRGFDEYQGIEVAWNQVKLYD
FLQSPQELERLYCEIHLLKTLKHKSIMKFYASWVDTDNRNINFVTEMFTSGTLRQYRLKH
KRVNIRAVKNWCRQILRGLNYLHTHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAACLQ
HSHAAHCVGTPEFMAPEVYKEEYNQLVDIYSFGMCVLEMVTFDYPYSECSHPAQIYKRVI
SGKKPDGLDKVKDPEVRGFIEKCLATVSLRLSACELLDDHFLCIDESDMRRVESEKGLID
EAGTPLRHSYHIPHYSNGYYSLYNQNQWDYNGDETVESHEIDLLEFQNDDDEEEEDKRFG
SVDISIKGKRRDNGDGLFLRLKTVNKEGCVRNIYFPFDIETDTAISVAREMVEELEMDDR
DVTKIANMIDGEIASLVPNWSIFCSSESNRSSVGSVMDFNEMQCGRDGCEEKHGRFEEIT
FEITVNDSDEED

www.000webhost.com

Other information
Ka divergence:0.243321KaKs divergence:0.423416
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):2103Length 2 (bp):1479Length divergence:-0.174
MFE 1 (kcal):-647.16MFE 2 (kcal):-410.17MFE divergence-0.224