Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04920-AT5G28060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein S24e family protein
Function (paralog2):Ribosomal protein S24e family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.24092519417243
Log2 mRNA fold difference:0.52023184198493
Log2 TE fold difference:-0.26796931508203
Sequences
Protein sequence

MAEKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFVF
KFRTHFGGGKSSGFGLIYDTVESAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR
GVKKTKAGDAKKK

MAEKAVTIRTRNFMTNRLLARKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFCF
KFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR
GVKKTKAGDTKKK

Other information
Ka divergence:1KaKs divergence:1
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):402Length 2 (bp):402Length divergence:0
MFE 1 (kcal):-106.8MFE 2 (kcal):-115.8MFE divergence0.04