Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04930-AT5G28040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA-binding storekeeper protein-related transcriptional regulator
Function (paralog2):DNA-binding storekeeper protein-related transcriptional regulator

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.26587225886633
Log2 mRNA fold difference:0.079059557962212
Log2 TE fold difference:-0.30358205418071
Sequences
Protein sequence

MTSDHRDALFSLELESPDPDEGGVADGGESDTDEDLRDNDDVVMPGTNEAEAEDDDPEEE
DLNSPSTSSLPMVSTISATAVVSGTPTATSSTGAVTVALPAGSAVPVSVIPVDSDPKWHR
MTEIVHQRPPIDDSRRLFQRLWTDEDEIELLRGFLDYMTMHRGSSSHPPDTAPFYEQIKS
KLQLDFNKNQLVEKLRRLKKKYRNVMSKISSGKEVFFKSPHDQSTFEISRKIWNQTGKII
GFEDNNVMDFEETNNHHNTTNGNYSTFNSPSSNPTLELDSENGIEKKLTMSSSSVSRKRS
RSRIGKIEEDNKPVITPSDGPIASNVNLNEAAAVGIGGNLGGLIEETVKNCVSPVIKEMM
NGTTSMMMAAMGGGFPGLGGGGGGGGGHGFGSLSPMFTRPFNFGFGVEGGGNKAVADERW
RKQQILELEVYSRRLELVQEQIRTTLNELKTMPSGI

MASDQRDTDFSAESPDLEEDGGGGGGGRGGGETESDEDVVIPEPNEAEDDDHDPDPDPEY
EDLNSPSMISRAPATKSSSGTVTVALPAGSAVPVASIPSDSDQKWHRMTEIVHQRPPIDD
SRRLFQRLWTDEDEIELLRGFLDYITNHRGNSSHPPDTAPFYEQIKSKLQLEFNKNQLVE
KLRRLKKKYRNVMSKFSSGKEVFFKSPHDQATFDISRKIWNQTGKIIGFEDNNVMDLEET
NHVNNANGSSGFNVSVIGNANVDVDSENGLEKKVTISRKRSRSRIGKIDEDKPVLAPCDG
VIPNAVNLNENVAVGCDFGDGRNLGVLIEETVKNCVSPMIKEMMNSTTGMMMAATGGFPG
GGAHALGVLSPMLMPSMNLGFGGKGVGDERWRRQQILELEVYSRRLELVQEQIRATVNEL
KTMPNGG

Other information
Ka divergence:0.323271KaKs divergence:0.162838
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1371Length 2 (bp):1284Length divergence:-0.033
MFE 1 (kcal):-452.3MFE 2 (kcal):-371.83MFE divergence-0.098