Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04940-AT5G28030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cysteine synthase D1
Function (paralog2):L-cysteine desulfhydrase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9663458223214
Log2 mRNA fold difference:-1.0536882812093
Log2 TE fold difference:-0.7063882062503
Sequences
Protein sequence

MEEDRCSIKDDATQLIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKERIAYGMIKDA
EDKGLITPGKSTLIEATSGNTGIGLAFIGAAKGYKVVLTMPSSMSLERKIILLALGAEVH
LTDPSKGVQGIIDKAEEICSKNPDSIMLEQFKNPSNPQTHYRTTGPEIWRDSAGEVDILV
AGVGTGGTLSGSGRFLKEKNKDFKVYGVEPTESAVISGGKPGTHLIQGIGAGLIPDNLDF
NVLDEVIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKVAKRPENAGKLIVVIFPS
GGERYLSTSLFESVRHEAENLPIQ

MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE
DKGLITPGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHL
TDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVA
GVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLS
IVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSG
GERYLSTELFESVRYEAENLPVE

Other information
Ka divergence:0.110988KaKs divergence:-0.999815
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):975Length 2 (bp):972Length divergence:-0.002
MFE 1 (kcal):-293.5MFE 2 (kcal):-287.5MFE divergence-0.01