Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G04980-AT5G27240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock N-terminal domain-containing protein
Function (paralog2):DNAJ heat shock N-terminal domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.09718348843596
Log2 mRNA fold difference:-0.76981363681623
Log2 TE fold difference:1.1702250940156
Sequences
Protein sequence

MEAGDFVGAHKFVTKAQRLFPNLENIVQMMTICDVHSSAIKKIKGLDDWYGVLQVQPYAD
ADTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQYDNRYRSHSMFAN
RHVNVYSGRHCAATNNAAENIAGVFTFWTRCRHCGQCYKYLREYMNTSMHCSSCQKSFVA
CKMRCDGVPPSSSTAGRKEFQDQVMSNTSRQNASTAAESGSSAADMGKNGKVGGKVNKKN
QEKQKNGAVNRGTKKEEGCTENDAEGRKPQTSETGTNISAEMPKADVLKPQHQVKEEPDT
SAEKSIPDLSAPQKNRAPKKKRKVVEESSKSFEVDSSDTAGAKTDTNEHNKRKSSRKKPQ
VSYAKEGSDGDFVSPPNKKTKSGFEFESEPNKKQTAEDNKSPKLAVSGVSSASSHSYKGK
AKKNAHSGNEDNLSAKNKVSEGCDGNGEDAALLSKIGRVEKGYKANENSNPLDIPDLEFS
VFKVERKTEDFAVNQVWSTTTDCRDGMPRKYARVKKVLNGEFKLRITYLDPVLDKTDESI
PVACGKFKNGKTMEVKDSSIFSGQMHHLRCNNIVSIYPRKGEIWAIFREWEEEWNTSLKK
HKFPYKYDFVEIVSDFHDLNGVGVAYLGKLKGSVQLFHWEPQHGICQIQCSPKDMLRFSH
KVPAVKMTGKEKESVPPNSYELDPAALPKDIFQVDAVDMEMDSEILKGKADGPYKVGAKA
KAVQETASSPRKRQKSDDDNDDGVCSNLGEVIGGSNRSHIFSSCEVDDKNTSTKSRKDGE
STDVFRLRKSPRLQTIPNHQGDEKKSAKQGNKMNTPKKMDKGLVTDSLGVDEKKTSKSRK
NGEATDVFKLRKSPRLQTIPSQQGDEMKSTKQGNKMNTPKKTDKGLETDSLGVRKSPNGI
HQPAESQEGESSKKQGCNGEIPSLSKQNDLPTQLGGSTYKSPRTTHVSPHCKTPRRNAFD
FQNLRSEDKFEVNQIWAIYSNDNGMPLEYVKIKKIETKPKFVLRGTPTELYPPSTEPVTR
TVSCGEFKLLKGRPKIIPHASFSHLVKPFDSSKRFRFKVYPRKGEIWALYKNCDSTEEPD
IVEVVEDNCDGEIVKVVALTAMGSSFQRKQGSDVGLIDISKAEMSRFSHQIPAIRHPKKT
TRLVKGGYYWELDPIAIPSRTIVID

MDWNKEEACRAKTLAEDKMKEGDFVGAQKLLLKAQSLFSGLESLPQMLAVCDVHNSAEKK
INCLENWYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAEAAFKLVWDASRFLADK
DKRSQYDIRRRIYLRLATNQLNANSGLQCAATNSATDTFWTCCEHCGYRYKYLRKYVNIL
LNCNICQRSYMAYDTGFNEAPSKSNTGQKEVQNQGPCNTSLNTNGESIGAQPGSVAAEVD
KKGTFNKKFNKRNGGGESKKTEVKNSKIETEFVRNDDEEKMKSAAKLHKPHPEVTEPEIG
ASKSVPDESVSRSDEAPSTSKDKNKMKKGVEESINVDGSDFIKDKAYSKDNNKRKSPRRS
QQSSYAEEEKISDNSLGPPKKRLRSNVGLKSEQTTRKGLVGVGSSKRFDSGGGSSAPSCA
FKRKAKKFVDSGYQEISSVKDKEREVRKASGEGVVMEAKIDNNHNPNENLITEDLPDPEF
SNFELTTSCFGVNQVWSMYDPIDGMPRLYARIDKVLVPEFKLWITWIDPLQDNKDNSIPI
ACGIFQGGGSEEENDHLKFSCQMFHLTRNNSVVIYPRKGEIWAIFRGWDISWSASSENHK
HPYEYDFVEVLSNFNDENGLGVGFLGKVEGFVSLFRQDAQDGVLQLQIPPSQMLRFSHKV
PSFKMTGKEREGVPPGCFELDPAALPKELFEVYDSKVDVGLDRELPNGKTGGPFPEASKV
EMQANTTRESSPFKKKRPKVHDNHGSFSKESDGRRTNHERNSAKESRKSVKAVDALNLRK
SPRLLSETNSQANSRSGRQIAEKKSANNGESCGKPGGLSLSGEKMSEKTITRMRKTPQDI
HKPTVNVKKHGRNDESLSQSRGDGLLTQLNGNMKSSEPETRVPSSCKTVKENTFNFENQR
SWDKFQIDQIWAIYSNDKGSPRKYAQIKKIDTSPEFKLHVAPLELYRPPIHMPRPVCCGR
FKLKTGKAEVYVPSSFSHQVKAVKTKKNRFEVYPGKGEIWALYKNCNTRDYTETEELEIV
EVVETDEQRIQAMTLTAKGFNNKPLYRRSEESNASFIDIPKTEVCRFSHQIPAFRHESRA
TRFGDGQYWELDLKAVLGLNLKNP

www.000webhost.com

Other information
Ka divergence:-0.0663809KaKs divergence:-0.263813
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):3498Length 2 (bp):3315Length divergence:-0.027
MFE 1 (kcal):-987.12MFE 2 (kcal):-928.49MFE divergence-0.031