Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05010-AT5G27210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, transmembrane-40
Function (paralog2):Protein of unknown function, transmembrane-40

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.5330637241449
Log2 mRNA fold difference:-1.3719653654535
Log2 TE fold difference:-0.14713803158313
Sequences
Protein sequence

MRVLSEIAESPFVISRLSPDSTATGGFIGGWVGKCHGFLHNTVLVLASILFVAYLAYEAK
KSLSKLSNRRSYIMIAYYGFLWLVSLLNLAWCCLQAWECTPGKEVIWNLLTLFTTSGMLF
LEVSLVAFLFQGNYASGAEALTRTFLISGLVIGLDLLLKAIYLFGFGVPLFIDNNEHIHK
FKWGLWVIHKLLLAGIYGMIFFMYNSKWRERLPARPAFYKYITVMLALNGLSLFACALTA
NGAHFGLWLYGITSVCYHAFYLPLLYVTFLADFFQEEDLNLENVYYSEMKDAGFFDADWE

MRVLDEIAESPFLISPLNPNSTANGYRWVDKCHGFLHNTVLVAASLFFVAYLAYEAKKSL
SKLSNRRSYIMIAYYGCLWLVSLLNLAWCCLQGWECTPGKEVVWNLLTLFTTSGMLFLEV
SLVAFLFQGNYASGAEALTRTFLISGFIVALDLLLKAIFLFGFGVPLFIDNNENGKTFKW
GLWIIHKLLLTGVYGMVFLMYNSRWREKLPARPAFYNYIIIMFALYSLYLVASAFTANNA
HFGFWLYGIMSVCYHALYLPLLYITFLADFFQEEDLNLENVYYSEMKDAGFFDSDWE

www.000webhost.com

Other information
Ka divergence:0.448572KaKs divergence:0.284874
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):903Length 2 (bp):894Length divergence:-0.005
MFE 1 (kcal):-268.6MFE 2 (kcal):-255.52MFE divergence-0.025