Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05030-AT5G27150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sodium hydrogen exchanger 2
Function (paralog2):Na+/H+ exchanger 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8215437490773
Log2 mRNA fold difference:2.103203597578
Log2 TE fold difference:-0.246365832769
Sequences
Protein sequence

MTMFASLTSKMLSVSTSDHASVVSLNLFVALLCACIVIGHLLEENRWMNESITALLIGLG
TGVVILLISRGKNSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMAFGAIGT
VVSCTIISLGAIQFFKKLDIGTFDLGDFLAIGAIFAATDSVCTLQVLNQDETPLLYSLVF
GEGVVNDATSVVLFNAIQSFDLTHLNHEAAFQFLGNFFYLFLLSTGLGVATGLISAYVIK
KLYFGRHSTDREVALMMLMAYLSYMLAELFALSGILTVFFCGIVMSHYTWHNVTESSRIT
TKHAFATLSFLAETFIFLYVGMDALDIEKWRFVSDSPGTSVAVSSILMGLVMLGRAAFVF
PLSFLSNLAKKHQSEKISIKQQVVIWWAGLMRGAVSMALAYNKFTRSGHTELRGNAIMIT
STITVCLFSTMVFGMLTKPLIRYLMPHQKATTSTTSMLSDDSTPKSIHIPLLDGEQLDSF
ELPGSHQDVPRPNSLRGFLMRPTRTVHYYWRQFDDAFMRPVFGGRGFVPFVPGSPTERSS
HDLSKP

MLDSLVSKLPSLSTSDHASVVALNLFVALLCACIVLGHLLEENRWMNESITALLIGLGTG
VTILLISKGKSSHLLVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFVTIMLFGAVGTII
SCTIISLGVTQFFKKLDIGTFDLGDYLAIGAIFAATDSVCTLQVLNQDETPLLYSLVFGE
GVVNDATSVVVFNAIQSFDLTHLNHEAAFHLLGNFLYLFLLSTLLGAATGLISAYVIKKL
YFGRHSTDREVALMMLMAYLSYMLAELFDLSGILTVFFCGIVMSHYTWHNVTESSRITTK
HTFATLSFLAETFIFLYVGMDALDIDKWRSVSDTPGTSIAVSSILMGLVMVGRAAFVFPL
SFLSNLAKKNQSEKINFNMQVVIWWSGLMRGAVSMALAYNKFTRAGHTDVRGNAIMITST
ITVCLFSTVVFGMLTKPLISYLLPHQNATTSMLSDDNTPKSIHIPLLDQDSFIEPSGNHN
VPRPDSIRGFLTRPTRTVHYYWRQFDDSFMRPVFGGRGFVPFVPGSPTERNPPDLSKA

www.000webhost.com

Other information
Ka divergence:0.293451KaKs divergence:0.267368
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1641Length 2 (bp):1617Length divergence:-0.007
MFE 1 (kcal):-478.31MFE 2 (kcal):-474.46MFE divergence-0.004