Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05060-AT5G27140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NOP56-like pre RNA processing ribonucleoprotein
Function (paralog2):NOP56-like pre RNA processing ribonucleoprotein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-5.5141757031831
Log2 mRNA fold difference:-5.3587954141678
Log2 TE fold difference:-0.10359825882003
Sequences
Protein sequence

MVLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEA
VAKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRS
QFTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM
RVREWYGWHFPELAKIISDNILYAKSVKLMGNRVNAAKLDFSEILADEIEADLKDAAVIS
MGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLISH
GGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKYGLIFHASLVGQAAPKHKGKISRS
LAAKTVLAIRVDALGDSQDNTMGLENRAKLEARLRNLEGKDLGRLSGSSKGKPKIEVYNK
DKKMGSGGLITPAKTYNTAADSLLGETSAKSEEPSKKKDKKKKKKVEEEKPEEEEPSEKK
KKKKAEAETEAVVEVAKEEKKKNKKKRKHEEEETTETPAKKKDKKEKKKKSKD

MLVLFETSGGFALFKVLDEGKLSNVEDLGTEFYSAESARRMGLHKFLKNNCDDGEILAVA
DPKLGDIITEKLDIECVHNDAVMELLRGVRSQLTELLSGLDDNDLAPVSLELSHILARYK
LKITSDKTMIILSISLLDDLDKELNTYTTSVCELYGLHFPELANIVQDNILYAKVVKLMG
NRINAATLDFSEILADEVEAELKEASMVSTRTEVSDLDLMHIQELCDQVLSIAEDKTLLC
DDLKNKMNKIAPNLTALVGELVGARLISHCGSLWNLSKLPWSTIQILGAEKTLYKALKTK
QATPKYGLIYHAPLVRQAAPENKGKIARSLAAKSALAIRCDAFGNGQDNTMGVESRLKLE
ARLRNLEGGDLGACEEEEEVNDKDTKKEADDEEEPKTEECSKKRKKEAELETVEDPAKKS
KQEVKDVVKTNKYVHKNVNIKVLSL

www.000webhost.com

Other information
Ka divergence:0.453829KaKs divergence:0.522884
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1602Length 2 (bp):1338Length divergence:-0.09
MFE 1 (kcal):-482.88MFE 2 (kcal):-380.84MFE divergence-0.118