Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05120-AT5G27320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.30262808136931
Log2 mRNA fold difference:-0.68590565005642
Log2 TE fold difference:0.29885076097108
Sequences
Protein sequence

MAASDEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPV
DGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHS
SANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKD
SKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVT
VRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAE
GLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAEC

MAGSEEVNLIESKTVVPLNTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKVPANANPV
NGVFSFDVIIDRQTNLLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSFAHSSA
NSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSSSWLRSKKDSK
VRIFLAGDSSGGNIVHNVAVRAVESRIDVLGNILLNPMFGGTERTESEKRLDGKYFVTVR
DRDWYWRAFLPEGEDREHPACSPFGPRSKSLEGLSFPKSLVVVAGLDLIQDWQLKYAEGL
KKAGQEVKLLYLEQATIGFYLLPNNNHFHTVMDEIAAFVNAECQ

www.000webhost.com

Other information
Ka divergence:-0.313007KaKs divergence:-0.120518
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1038Length 2 (bp):1035Length divergence:-0.001
MFE 1 (kcal):-318.54MFE 2 (kcal):-316.6MFE divergence-0.003