Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05130-AT5G27330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):Prefoldin chaperone subunit family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.7854215804309
Log2 mRNA fold difference:1.9530790905747
Log2 TE fold difference:-0.18540272200311
Sequences
Protein sequence

MAKKKASRNSNDTANDNRQQQHDQKAPETDKKATVLSRQSSMEEHDSSEEQFQNLKSLNA
MLLKQAMEKRNQIDSLVQAKDELETELARYCQEKTGLRDELDQVSDENFGLKFELDFVIV
FVESQFREMCVGVDMLVKEKSDRESEIRVLKGEAIELTGKVEIEKEQLRKVCDERDLIKN
GFDLQHEEVNRLKECVVRLEEKESNLEIVIGKLESENERLVKERKVREEEIEGVKKEKIG
LEKIMEEKKNEIDGLKREIKVLLSEKNEMEIVKIEQKGVIEELERKLDKLNETVRSLTKE
EKVLRDLVIGLEKNLDESMEKESGMMVEIDALGKERTIKESEVERLIGEKNLIEKQMEML
NVQSSDKGKLIDQLSREKVELEERIFSRERKLVELNRKADELTHAVAVLQKNCDDQTKIN
GKLSCKVDQLSNALAQVELRREEADKALDEEKRNGEDLKAEVLKSEKMVAKTLEELEKVK
IERKSLFSAKNDLESQSESLKSENVKLEKELVELRKAMEALKTELESAGMDAKRSMVMLK
SAASMLSQLENREDRLISEEQKREIGTEPYAMELESIEKAFKNKEDIIEEMKKEAEIMKQ
STEEAHKKQTFWTLVSSVTTVFAAASFAYAARAR

MAKKKVSRNSNGASNEQQQIQNQSVPVTSQKSTKLSRESSMEDHDSSEEKFQNLKSLNAI
LLKQTMEKRQQIESLFQAKDSLEIELVRSGKEKTLLREELCGSSDENFMLKIEMDLLMGF
VEGRVKEMGVEVDWLFKEKSDRETEIRDLKREANGLIRKLESEREEFSRVCDERDLVKSG
FDLQSEEMNLLKESVVRLEMREVSLGEEVGRLKCENGRLVKERKKREEVIERGNRERSEL
VESLEEKVREIDVLKREIEGVVKEKMEVEMVRRDQREMIVELEKKLGDMNEIVESLTKER
EGLRGQVVGLEKSLDEVTEEAKARAEQINELVKEKTVKESELEGLMVENNSIKKEIEMAM
VQFSDKEKLVEQLLREKNELVQRVVNQEAEIVELSKLAGEQKHAVAQLRKDYNDQIKNGE
KLNCNVSQLKDALALVEVERDNAGKALDEEKRNMVALKEKVVALEKTNEATGKELEKIKA
ERGRLIKEKKELENRSESLRNEKAILQKDIVELKRATGVLKTELESAGTNAKQSLTMLKS
VSSLVCGIENKKDEKKRGKGMDSYSVQLEAIKKAFKNKESMVEEMKKELAKMKHSVEDAH
KKKSFWTLVSSVTSLLMAASVAYAASLK

www.000webhost.com

Other information
Ka divergence:0.0163454KaKs divergence:-0.0991083
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1905Length 2 (bp):1887Length divergence:-0.005
MFE 1 (kcal):-467.39MFE 2 (kcal):-490.66MFE divergence0.024