Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05200-AT5G27420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):carbon/nitrogen insensitive 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.19800445805568
Log2 mRNA fold difference:0.27097424954182
Log2 TE fold difference:-0.1679138474691
Sequences
Protein sequence

MRSSDHMAFAGVLPIVFLLILSSADLAASQSQPGPTNQPYNYGRLSPAMAVIVVILIAAL
FFMGFFSIYFRHCSGVPDAGVSPAGGARSRATVNAAARGLDVSVVETFPTFLYSDVKTQK
LGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWLEAHVTCPVCRANLAEQVAEG
ESVEPGGTEPDLELQQVVVNPEPVVTAPVPEQLVTSEVDSRRLPGVPVDLKRVKFSRSHT
TGHSVVQPGECTERFTLRLPEDVRKRIMKDWKLNRTNSLLVLPRGGSSRRGKPIDRSRAR
SDRWLFRKTPSFLWRSRDDGSIRLGATGSVRASAVPNSTGSDSVRAGDRWAFLRNASFLW
RNSSVHVPRGGVNKDGEGTSVKSTGASGSTSGSVRLPV

MDPIKHISLPVLVLFLLLSVSAGQPGTPDQRHDPYAYSGSLSPAMAVVVVVVIAALFFMG
FFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVYSEVKTQKIGKG
ALECAICLNEFEDDETLRLLPKCDHVFHPHCIGAWLQGHVTCPVCRTNLAEQTPEPEVVV
ETDLEAQQQSAVPVPVVELPRVKFPRSHTTGHSVVLPGESTDRFTLRVPEELRKKIMANW
KLNRSNSVFVLPRGGSSRSGKQVDRSRAKSDRWLFRKTPSFLWRNRDDGSIRLGGTGSVR
GNSVTSPSGDSVRADRWAFLRNPSFLWRNTTPVPSPRVEVNNKDGEGTSSVQHIGTVGST
SGSLRLPV

Other information
Ka divergence:0.104792KaKs divergence:0.221508
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):1197Length 2 (bp):1107Length divergence:-0.039
MFE 1 (kcal):-427.8MFE 2 (kcal):-402.54MFE divergence-0.03