Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05230-AT5G27430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Signal peptidase subunit
Function (paralog2):Signal peptidase subunit

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.42794081180901
Log2 mRNA fold difference:-0.61057733333716
Log2 TE fold difference:0.17299424280135
Sequences
Protein sequence

MHTFGYRANALLTFAVTALAFICAIASFSDKFSNQNPSAEIQILNINRFKKQSHGNDEVS
LTLDISADLQSLFTWNTKQVFVFVAAEYETPKNSLNQVSLWDAIIPAKEHAKFRIQVSNK
YRFIDQGQNLRGKDFNLTLHWHVMPKTGKMFADKIVLPGYSLPDAYR

MHSFGYRANALLTFAVTILAFICAIASFSDNFSNQNPSAQIQILNINWFQKQPHGNDEVS
LTLNITADLQSLFTWNTKQVFAFVAAEYETSKNALNQVSLWDAIIPEKEHAKFWIQISNK
YRFIDQGHNLRGKDFNLTLHWHVMPKTGKMFADKIVMSGYRLPNAYR

www.000webhost.com

Other information
Ka divergence:-0.771068KaKs divergence:0.999808
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):504Length 2 (bp):504Length divergence:0
MFE 1 (kcal):-133.08MFE 2 (kcal):-130.96MFE divergence-0.008