Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05280-AT5G27490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integral membrane Yip1 family protein
Function (paralog2):Integral membrane Yip1 family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.2653536808143
Log2 mRNA fold difference:-1.4850131418511
Log2 TE fold difference:0.22700088033224
Sequences
Protein sequence

MMSGGNYTTIDSQKVSGSVPSVPDPGHTTVKFAESNLQTFPPSATQGKISGGSNPPRDAD
DSFSGHGNGSTDEPQSGGWLHKFTVGAYKPFFDVDTSDVVERLKESLFPFRGTFTEKTAD
KPDLYGPFWICTTLIFVAASIGTFVTYIAHKWKKQEWNYDINLVTWSAGVFYGYVTIVPL
ALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPALCLSVVPVEIFRWVIAGVAGFMSATFVA
LNLKAHINSAGERSILIIASIFLLQLALAVVLKLYIFNVKV

MMMSGGSYTNIDHQKVSGSVPAVPDPGHVTVKFADSNLQTFPPSATQGKISGGTNPPRDA
DDTFSRPVNGTTDEPQSSGWLHRFTVGAYKPYFDVDTSDVVERLKESLFPFRGTFTEKTA
NNPDLYGPFWICTTLIFVAASIGTFVTYIAHKLKKQEWNYDINLVTWSAGVFYGYVTIVP
LALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPALCLSVVPLEIFRWVIAGLAGFMSATFV
ALNLKAHINSAGERWFLIVVSIFLLQLALSVVLKLYLFTVTV

www.000webhost.com

Other information
Ka divergence:-0.490992KaKs divergence:-0.780371
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):846Length 2 (bp):849Length divergence:0.002
MFE 1 (kcal):-233MFE 2 (kcal):-232MFE divergence-0.002