Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05290-AT5G27520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):peroxisomal adenine nucleotide carrier 1
Function (paralog2):peroxisomal adenine nucleotide carrier 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.87812296875815
Log2 mRNA fold difference:1.2482409433213
Log2 TE fold difference:-0.34676405073547
Sequences
Protein sequence

MGVDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISK
GQVFSLYQGLGTKNFQSFISQFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACT
SVLIQPLDTASSRMQTSEFGESKGLWKTLTEGSWADAFDGLGISLLLTSNPAIQYTVFDQ
LKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKE
NETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTW
ILILAIRRTLFLTNTKGKLRSP

MGVDLDLESISEATSGAIGSLLSTTILYPLDTCKSKFQAEIRVRGQQKYRYLSDVFWEAI
SSGNVLSLYQGLGTKNLQSFISSFIYFYSYSYFKRLHSQRIGSKSIGTKANLLIAAAAGA
CTSVLTQPLDTASSRMQTSEFGKSKGLWKTLTDGSWGNAFDGLGISLLLTSNPAIQYTVF
DQLKQNLLEKGKAKSNKDSSPVVLSAFMAFVLGAVSKSAATVITYPAIRCKVMIQAADDS
KENEAKKPRKRIRKTIPGVVYAIWKKEGILGFFKGLQAQILKTVLSSALLLMIKEKITAT
TWILILAIRTLFVTKARLKSP

Other information
Ka divergence:0.123718KaKs divergence:0.2
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):969Length 2 (bp):966Length divergence:-0.002
MFE 1 (kcal):-277.02MFE 2 (kcal):-272.14MFE divergence-0.009