Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05380-AT5G27610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DIRP ;Myb-like DNA-binding domain
Function (paralog2):DIRP ;Myb-like DNA-binding domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.82488665949834
Log2 mRNA fold difference:-0.36114267804741
Log2 TE fold difference:-0.39775862164768
Sequences
Protein sequence

MAPVRKSRSVNKRFTNETSPRKDAGKSKKNKLRKKKLSDKLGPQWTRLELERFYDAYRKH
GQEWRRVAAAIRNSRSVDMVEALFNMNRAYLSLPEGTASVAGLIAMMTDHYSVMEGSGSE
GEGHDASEVPRKQQKRKRAKPQRSDSPEEVDIQQSIGSPDGCLTFLKQARANGTQRHATG
KRTPRVPVQTSFMRDDREGSTPPNKRARKQFDANDDVAHFLALALTDASRRGGSPKVSES
PNRRTELSDSSPIKSWGKMSRTRKSQSKHCGSSIFEEWMESSRERKLDSDKDTTLLMDME
RAGEMEAPRKGKRVYKKRVKVEEAECNDSDDNGEACSATQGLRSKSQRRKAAIEASREKY
SPRSPKKRDDKHTSGAFDALQALAELSASMLPANLMESELSAQLKEERTEYDMDEKSSTP
EATSTSSHGEKANVEPDDSLLHAISSVENANKRKSKPSRLVSTDCDDVPTGKLQPQTSGS
LRKRKPKVLGDEAPAEFSQNKSINKKELPQDENNMKSLVKTKRAGQVPAQSKQMKTVKAL
EESAITSDKKRPGMDIVASPKQVSDSGPTSLSQKPPNRRKKSLQKSLQEKAKSSETTHKA
ARSSRSLSEQELLLKDKLATSLSFPFARRRCIFEWFYSAIDHPWFSKMEFVDYLNHVGLG
HIPRLTRLEWSVIKSSLGRPRRFSERFLHEEREKLKQYRESVRKHYTELRTGAREGLPTD
LARPLAVGNRVIAIHPKTREIHDGKILTVDHNKCNVLFDDLGVELVMDIDCMPLNPLEYM
PEGLRRQIDKCLSMKKEAQLSGNTNLGVSVLFPPCGLENVSFSMNPPLNQGDMIAPILHG
KVSSNTSSPRQTNHSYITTYNKAKEAEIQRAQALQHALDEKEMEPEMLEIVKGSKTRAQA
MVDAAIKAASSVKEGEDVNTMIQEALELVGKNQLLRSSMVKHHEHVNGSIEHHHNPSPSN
GSEPVANNDLNSQDGSEKNAQMPSELITSCVATWLMIQMCTERQYPPADVAQLIDAAVTS
LQPRCPQNLPIYREIQTCMGRIKTQIMSLVPT

MAPTRKSKSVNKRFTNEASPDINFGSASKTKQRKKKLADKLGPQWTKRELVRFYDAYRKY
VGDWKKVAAAVRNNRSVEMVETLFCMNRAYLSLPEGTASVAGLIAMMTDHYSVMEGSESE
GEDHDASEVTRKHLKRKRPQVLPSDFREEVVPPHSVASVEGCLSFLKQTQAYEKRQRATG
KRTPRFLVAITHERDDIEDFSPPNKRAKKQLDADDDASRRGGGSPYRRKELSEITPTRLR
KTSQAQEAQFKHPDSSMFENGVRDRWHKKGAADRDGALLMDMEGLVTQKEKIVRVEEAEG
NYSDDDDGLGALKTLAEMSASLAPAGLLESESSPHWEEERKTNNVDKKSNTLETVSTSHH
REKAKQAGLEDNLLHAISAPDKRKPKSVPESVDGNVVSIEELRTSSRKRKPKFQVLDVVA
PKESTQDKSLYTKESAEVDSLKTPVKARRSSQGPAKQLKTAKTTVESSSASDKKITGPDA
VVPATQVSASGPETLPQKPPNRRKISLKKSLQERAKSLETTHDKPRSFKKLSEHELLQEK
LSNCLSYPLVRRWCIYEWFYSAIDYPWFAKMEFTDYLNHVGLGHAPRLTRVEWSVIKSSL
GRPRRLSQRFLQDERDKLQEYRESVRKHYTELRGCATGVLHTDLARPLSVGNRVIAIHPK
TREIRDGKILTVDHNKCNVLFDELGVELVMDIDCMPLNPLEYMPEGLRRQIDKCLAICKE
ARLNRHPSSDASVLFSPSVLENVNFSMNPPPAKQDDIREPVLYGKVIATNTTDQSIVINS
KVTGTEIQRTLALQHTSDAQEMEPEMIEIVIESKSIAQAMVDAAIKAASSGKNNEDSENM
VHQALSSIGEHQPLDNSIVPGIKHQEYTNGSLDHHSLNTAEPMSNGFISQEGSGKNKTPM
PSELITSCVASWLMMQMISKKQYPPADVAQLMDTVVNDLQPRCPQNMPIYREIQTCMGLI
KTQIMALVRTS

www.000webhost.com

Other information
Ka divergence:0.112725KaKs divergence:-0.484109
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):3159Length 2 (bp):2916Length divergence:-0.04
MFE 1 (kcal):-933.88MFE 2 (kcal):-855.95MFE divergence-0.044