Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05420-AT5G27630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):acyl-CoA binding protein 4
Function (paralog2):acyl-CoA binding protein 5

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.6705332845954
Log2 mRNA fold difference:-5.3498761477932
Log2 TE fold difference:0.70727925831261
Sequences
Protein sequence

MAMPRATSGPAYPERFYAAASYVGLDGSDSSAKNVISKFPDDTALLLYALYQQATVGPCN
TPKPSAWRPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEDDPGWYSRASNDIPDPVVDVQ
INQRAKDEPVVENGSTFSETKTISTENGRLAETQDKDVVSEDSNTVSVYNQWTAPQTSGQ
RPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVATESQETSTPT
LLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGKPPVSRGGQS
VTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERFL
LIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNKS
GASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEIN
LLKPSHKSTLQTKTLEAPLPGSLSAVNNATTRDIESEVEVSQEGRVREIVMDNVNPGSKV
EGNSERIIATIKSEKEELEASLNKERMQTLQLRQELGEAELRNTDLYKELQSVRGQLAAE
QSRCFKLEVDVAELRQKLQTLETLQKELELLQRQKAASEQAAMNAKRQGSGGVWGWLAGS
PQEKDDDSP

MAHMVRASSGLSYPERFYAAASYVGLDGSQSSVKQLSSKFSNDTSLLLYTLHQQATLGPC
SIPKPSAWNPVEQSKWKSWQGLGTMPSIEAMRLFVKILEEADPGWYPRTSNSVLDPAVHV
QINSTKAEPSFESGASFGETKTITSEDGRLTETQDKDVVLEDPDTVSVYNQWTAPRTSGQ
PPKARYQHGAAVIQDKMYMYGGNHNGRYLGDLHVLDLKNWTWSRVETKVVTGSQETSSPA
KLTHCAGHSLIPWDNQLLSIGGHTKDPSESMPVMVFDLHCCSWSILKTYGKPPISRGGQS
VTLVGKSLVIFGGQDAKRSLLNDLHILDLDTMTWEEIDAVGSPPTPRSDHAAAVHAERYL
LIFGGGSHATCFDDLHVLDLQTMEWSRHTQQGDAPTPRAGHAGVTIGENWYIVGGGDNKS
GASKTVVLNMSTLAWSVVTSVQEHVPLASEGLSLVVSSYNGEDIVVAFGGYNGHYNNEVN
VLKPSHKSSLKSKIMGASAVPDSFSAVNNATTRDIESEIKVEGKADRIITTLKSEKEEVE
ASLNKEKIQTLQLKEELAEIDTRNTELYKELQSVRNQLAAEQSRCFKLEVEVAELRQKLQ
TMETLQKELELLQRQRAVASEQAATMNAKRQSSGGVWGWLAGTPPPKT

www.000webhost.com

Other information
Ka divergence:0.292834KaKs divergence:0.26565
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2010Length 2 (bp):1947Length divergence:-0.016
MFE 1 (kcal):-633.25MFE 2 (kcal):-595.9MFE divergence-0.03