Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05430-AT5G27650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tudor/PWWP/MBT superfamily protein
Function (paralog2):Tudor/PWWP/MBT superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.5303588141627
Log2 mRNA fold difference:2.7964904059281
Log2 TE fold difference:-1.2726242650806
Sequences
Protein sequence

MNSAEVNVNPRVFGDSFVTFSGNGSGKFEMIDQAEAFLMELDSVAADTGSDGNGNVDLGS
RVSNSETEPRFCEMKREIRDSDHRFYELCNESGEKKMEKRRVPDYKSFLSEFDDYVAREK
MGSRNSKALSYGFEVGDMVWGKVKSHPWWPGQIFNEAFASPSVRRVKKMGYVLVAFFGDN
SYGWFDPAELIPFEPHVKEKSQQTSSDHFAKAVEEAMNEVGRRSALGLTCKCRNQYNFRP
INAQGYFAVDVPDYEVQAIYSSKQIQKARDSFSSVQTLAFVKRCALAPQECDTDSLKSFQ
KKVAVCAFRRAVFEEFDETYEQAFRARSVYCLMKTHEPLNRAPLRVPLSGSLVSAETLGN
PKSYTKAMNVKDSTKQDKYLPKRREEAGDMTVQFGQVQESSQFQGINGSSAWDRLLQRRT
PCLQTPRKHEQTGLVSMNFTSSSGNIPGKKSSVSKLSRDDDKGLAQESDVRMGEKATLFP
DQEKFEPMKSLKQDETGTNSRSNKSSLKLFSGGKFSAGVGIKKGNVVKRSSGEMKSENCP
PEPKKKKKEYVSELNRDTPDKRKALSSGEAWAKKSSQVDSAKRRSNMLIVKLDGLQLLSN
LLALSLDPLFGSSDRSSFRVIRQFFFHFRSHVYQKSLATSPSATKLSKSAKTLCRANEQS
KAGRNRISSDSQQDVPSTKKLKKTIQFKPLASDKKTNQDATKRSSLAPLNPVRDQCRVPI
NAKPAIVQQEKKTGPSAMVVEPTMLVMMFPPGESLPSIDLLKARFGRFGQLDQSAIRVSW
KSSICRVGFLYKLDAQTALRYVSGSKSLFGNVNVTYFLRDMKASSASGDHELKKAKRPKT
DKPITKPLNQLLEQAPPVHQPNIQLKSCLKKPGNNRNGNHRTVRVKFMLGEKETESPFSV
SILPLSSQDSEPKPVNNQVDHVEPPLDPSQLKVDISLQMMELLTRCNDAVANVTGLLGYV
PYHSL

MYKTKLIPVMNEDAVIVQQTDSIQDPKVTPDDTVVDSSGDVHEAIDDDVEASSPMELDSA
VTNDARVLESERSEKDGVVGSEEEDEIKSEDVLIDKDDESSEVKEEEEEEDGSDDQSSEL
GSEADEKELDLGLKEEKKGVSDYKSLLSEFDDYVASEKMGSGVSRALSYGFEVGDLVWGK
VKSHPWWPGHIFNEAFASPSVRRMRRIDHVLVAFFGDSSYGWFDPAELIPFEPNLEEKSQ
QTVSKHFVRAVEEAKDEASRRSALGLTCKCRNPYNFRPSNVEDYFAVDVPDYELQAVYSV
DQIKNSRDKFLPAETISFVKQLALAPQECDPDSLKFMKKKAVVFAFRKSVFEEFDETYAQ
AFGTKSPRSSVSTLEPHNRAPPRAPLSGPLVIAETLGDLKSSKKPTKVKVSKKKDKYLLK
RRDEAGDKSVQFGEIEASSEASHIQGIDGSLDGDFGLQRRAPTLQTPMKDEKSGIVSMDF
ASSNTAIPGKEFSASKPSLDEEKGLAEKSKERMEERAAVLPEHGKSEAMASLKPKEEAGT
DLGSAGSSLQPLLESHTSASEGKSSTGSVIKKVKVAKRSSSEMSSENPPSEPKKKKKKKK
EPDSDHPVKRKNLYSGEAGAKKLSQLGSAHLQTYMEADVPQLLSHLQDLSLDPFHGLSVA
SFGTARKFFLRFRSLNYQKSLSVSSSDATVENARDTKPSKPVKTVKRTEDPSKAGKKRLS
SDRQDEIPSAKKLKKTNQLKSMASEKKIIREAKDSIKPIREPSRVVQAKPARGQTGKKTA
PSVKVVEPTMLVMKFPPGTSLPSAALLKARFGRFGLLDQSAIRVFWKSSTCRVVFLYKAD
AQTAFRYATGNNTLFGNVNVKYFLRDVDAPKAEPREPENTKEDDEPQSQWLDQAPPLHQP
TLPPPNVNLKSCLKKPVDDPSSSSNNGNGNRAAVRVKFMLGGEENSSKANTEPPQVTMTL
NRNSGPSSSSSSVPMEFVSKKFQNVVHHQQLPPSTLPPILPLPPQYTKPQQLPIKPVDHV
EPPMPPSRNFRGPIPAVSAGDISHQMLNLLSKCNEVVANVTGLLGYVPYHPL

www.000webhost.com

Other information
Ka divergence:-0.236282KaKs divergence:-0.0628408
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2898Length 2 (bp):3219Length divergence:0.052
MFE 1 (kcal):-836.01MFE 2 (kcal):-968.7MFE divergence0.074