Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05580-AT5G27840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcineurin-like metallo-phosphoesterase superfamily protein
Function (paralog2):Calcineurin-like metallo-phosphoesterase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.3534457799072
Log2 mRNA fold difference:1.690124902733
Log2 TE fold difference:0.6476126562124
Sequences
Protein sequence

MMTSMEGMMEMGVLDDIIRRLLEGKGGKQVQLSEVEIRQLCVNARQIFLSQPNLLELHAP
IRICGDIHGQYQDLLRLFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKI
FLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALIDEKILCMHGGLSP
ELENLGQIREIQRPTEIPDNGLLCDLLWSDPDQKNEGWTDSDRGISCTFGADVVADFLDK
NDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKP
APASSTNPLKKVPKMGKS

MMTSMEGMVEKGVLDDIIRRLLEGKGGKQVQLSESEIRQLCFNARQIFLSQPNLLDLHAP
IRICGDIHGQYQDLLRLFEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKI
YLLRGNHEDAKINRIYGFYDECKRRFNVRLWKVFTDCFNCLPVAALIDEKILCMHGGLSP
DLDNLNQIREIQRPIEIPDSGLLCDLLWSDPDQKIEGWADSDRGISCTFGADKVAEFLDK
NDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDESLVCSFEIMKP
APASSSHPLKKDFHNRTLGYNLSA

www.000webhost.com

Other information
Ka divergence:0.21275KaKs divergence:0.00152905
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):957Length 2 (bp):975Length divergence:0.009
MFE 1 (kcal):-288.45MFE 2 (kcal):-293.93MFE divergence0.009