Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05640-AT5G27930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2C family protein
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2961411399063
Log2 mRNA fold difference:-0.15841772638017
Log2 TE fold difference:-0.75847020889119
Sequences
Protein sequence

MGHFSSMFNGIARSFSIKKAKNINSSKSYAKEATDEMAREAKKKELILRSSGCINADGSN
NLASVFSRRGEKGVNQDCAIVWEGYGCQEDMIFCGIFDGHGPWGHFVSKQVRNSMPISLL
CNWKETLSQTTIAEPDKELQRFAIWKYSFLKTCEAVDLELEHHRKIDSFNSGTTALTIVR
QGDVIYIANVGDSRAVLATVSDEGSLVAVQLTVDFKPNLPQEEERIIGCNGRVFCLQDEP
GVHRVWQPVDESPGLAMSRAFGDYCIKDYGLVSVPEVTQRHISIRDQFIILATDGVWDVI
SNQEAIDIVSSTAERAKAAKRLVQQAVRAWNRKRRGIAMDDISAVCLFFHSSSSSPSL

MGHFSSMFNGLARSFSIKKVKNNNGNCDAKEAADEMASEAKKKELILKSSGYVNVQGSNN
LASLFSKRGEKGVNQDCALVWEGFGCQEDMIFCGIFDGHGPWGHYVAKQVRNSMPLSLLC
NWQKILAQATLEPELDLEGSNKKISRFDIWKQSYLKTCATVDQELEHHRKIDSYYSGTTA
LTIVRQGEVIYVANVGDSRAVLAMESDEGSLVAVQLTLDFKPNLPQEKERIIGCKGRVFC
LDDEPGVHRVWQPDAETPGLAMSRAFGDYCIKEYGLVSVPEVTQRHISTKDHFIILASDG
IWDVISNQEAIEIVSSTAERPKAAKRLVEQAVRAWKKKRRGYSMDDMSVVCLFLHSSSSS
SLSQHHHAMTILK

www.000webhost.com

Other information
Ka divergence:0.0840076KaKs divergence:0.0955585
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1077Length 2 (bp):1122Length divergence:0.02
MFE 1 (kcal):-353.7MFE 2 (kcal):-339.76MFE divergence-0.02