Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05650-AT3G05660
Species:Arabidopsis
Duplication type:TD
Function (paralog1):receptor like protein 32
Function (paralog2):receptor like protein 33

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.72588090899978
Log2 mRNA fold difference:0.24564155419017
Log2 TE fold difference:-1.0073640201007
Sequences
Protein sequence

MKDSWNSTSIIPFTFSSLIFFLFTFDFQDVFGVPTKHLCRLEQRDALLELKKEFKIKKPC
FDGLHPTTESWANNSDCCYWDGITCNDKSGEVLELDLSRSCLQSRFHSNSSLFTVLNLRF
LTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGNEFV
GEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLSNL
EYFEAWGNAFTGTLPSSLFTIASLTSINLRNNQLNGTLEFGNISSPSTLTVLDISNNNFI
GPIPKSISKFINLQDLDLSHLNTQGPVDFSIFTNLKSLQLLNLSHLNTTTTIDLNALFSS
HLNSIYSMDLSGNHVSATTKISVADHHPTQLISQLYLSGCGITEFPELLRSQHKMTNLDI
SNNKIKGQVPGWLWTLPKLIFVDLSNNIFTGFERSTEHGLSLITKPSMQYLVGSNNNFTG
KIPSFICALRSLITLDLSDNNLNGSIPPCMGNLKSTLSFLNLRQNRLGGGLPRSIFKSLR
SLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNAFHGP
IHHASFHTLRIINLSHNQFSGTLPANYFVNWNAMSSLMATEDRSQEKYMGDSFRYYHDSV
VLMNKGLEMELVRILKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSM
GNLRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVPGGTQFRRQNCSSFKD
NPGLYGSSLEEVCLDIHAPAPQQHEPPELEEEDREVFSWIAAAIGFGPGIAFGLTIRYIL
VFYKPDWFMHTFGHLQPSAHEKRLRRKQ

MSLIPITFYFLFLFFSNFRGVFAVPNIHLCHFEQRDALLEFKNEFKIKKPCFGCPSPLKT
KSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSY
NHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLG
NLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSH
NQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNI
SSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYL
SHSNTTTTIDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGITEF
PDILRTQRQMRTLDISNNKIKGQVPSWLLLQLEYMHISNNNFIGFERSTKLEKTVVPKPS
MKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRL
SGSLPKTIIKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKL
QVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEK
YMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSS
NGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQ
FRTQSASSFEENLGLCGRPLEECRVVHEPTPSGESETLESEQVLSWIAAAIGFTPGIVLG
LTIGHIVLSSKPRWFFKVLYINNSRRRRRTRSEKS

www.000webhost.com

Other information
Ka divergence:-0.0492716KaKs divergence:-0.82205
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2607Length 2 (bp):2628Length divergence:0.004
MFE 1 (kcal):-669.69MFE 2 (kcal):-679.04MFE divergence0.007