Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05700-AT5G26990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Drought-responsive family protein
Function (paralog2):Drought-responsive family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.5914060415922
Log2 mRNA fold difference:0.99259447893037
Log2 TE fold difference:0.58165708063162
Sequences
Protein sequence

MDSDSWSDRLASATRRYQLAFPSRSDTFLGFEEIDGEEEFREEFACPFCSDYFDIVSLCC
HIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHRKRKPRRGGSYSTLSILRR
EFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFISPIADGFFTTESCISAETGPVKKT
TIQCLPEQNAKKTSLSAEDHKQKLKRSEFVRELLSSTILDDSL

MDSDSWSDRLASASRRYQLDFLSRSDNFLGFEEIEGEDDFREEYACPFCSDYFDIVSLCC
HIDEDHPMDAKNGVCPICAVKVSSDMIAHITLQHANMFKVTRKRKSRRGGAQSMLSILKR
EFPDGNFQSLFEGTSRAVSSSSASIAADPLLSSFISPMADDFFISESSLCADTSSAKKTL
NQSLPERNVEKQSLSAEDHREKLKQSEFVQGILSSMILEDGL

www.000webhost.com

Other information
Ka divergence:0.309264KaKs divergence:0.481604
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):672Length 2 (bp):669Length divergence:-0.002
MFE 1 (kcal):-195.2MFE 2 (kcal):-203.78MFE divergence0.022