Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05710-AT5G26980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):syntaxin of plants 43
Function (paralog2):syntaxin of plants 41

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.6553112491027
Log2 mRNA fold difference:-0.50430921616117
Log2 TE fold difference:-1.1301508025134
Sequences
Protein sequence

MATRNRTLLFRKYRNSLRSVRAPMGSSSSSTLTEHNSLTGAKSGLGPVIEMASTSLLNPN
RSYAPVSTEDPGNSSRGTITVGLPPDWVDVSEEISVYIQRARTKMAELGKAHAKALMPSF
GDGKEDQHQIETLTQEVTFLLKKSEKQLQRLSAAGPSEDSNVRKNVQRSLATDLQNLSME
LRKKQSTYLKRLRLQKEDGADLEMNLNGSRYKAEDDDFDDMVFSEHQMSKIKKSEEISIE
REKEIQQVVESVSELAQIMKDLSALVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKAERT
QRQGGMVMCASVLVILCFIMLVLLILKEILL

MATRNRTLLFRKYRNSLRSVRAPLSSSSLTGTRSGGVGPVIEMASTSLLNPNRSYAPIST
EDPGTSSKGAITVGLPPAWVDVSEEISVNIQRARTKMAELGKAHAKALMPSFGDGKEDQH
NIESLTQEITFLLKKSEKQLQRLSASGPSEDSNVRKNVQRSLATDLQLLSMELRKKQSTY
LKRLRQQKEDGMDLEMNLSRNRYRPEEDDFGDMLNEHQMSKIKKSEEVSVEREKEIQQVV
ESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVEDGLKQLQKAERTQRHGGMVKC
ASVLVILCFIMLLLLILKEIFL

Other information
Ka divergence:-0.0852878KaKs divergence:-0.0240752
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):996Length 2 (bp):969Length divergence:-0.014
MFE 1 (kcal):-305.1MFE 2 (kcal):-283.16MFE divergence-0.037