Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05750-AT5G26910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.42358267407119
Log2 mRNA fold difference:0.27035947700252
Log2 TE fold difference:-0.25411134842983
Sequences
Protein sequence

MVEMEAVERKRSRGGFLNMFDWPGKSRKKLFSSSSSSSKLSEGSKQEKQNAQNPSKSWPS
LIEGDEIGKNSTYNPRSDSSCSTSTPTSDDGQGSKAPSVVARLMGLESIPVPNALEPRRN
PDFDPYFLRSSRKASTWDAYENLGYVNLRSDYDGISWDHLDSRMNKECNRPIDRFQTETL
PPRSAKPIPVTHNRLLSPIRSPGFVQSRNPASVMEEASRMIEPSPRVVAKTRFSSSDSSS
SLPMKIRDLKEKLEASQKGQSPQISNGTCNNKCFRGKQDEKRTTLPLKTQERNNLLGESR
FGGSKGKVKPPSVSAHAKANTIHKRDSSMLSNGYRDQKKKVETKNRIVKSGLKESSASTR
KTVDKPNNQKQNQFAETSVSNQRGRKVMKKVNKVLVENGTTTKKPGFTATSAKKSTSSSL
SRKKNLSRSKKPANGVQEAGVNSDKRIKKGEKVIKCNITVDGGLKTGDDDRKKDMDVISF
TFSSPIKGLSSDSQYFLKKNDQDAESALCFNKIDSDSLNFLLEKKLRELTSKMESSCSSL
TQEEESSGSITKDWVNGTRSLPSDDQDNGLSESESDSDYSSSFYKKKIFQAEDDEEVNSF
STAENLQISCSTSFSSSRNDYHHNIEETELSESVALSEAEEGHDWELEYITEIIASGQLM
IKEFSLGMATDILPLSLFDETEGKRDARGKIERKTLFDLVNQWLTLKCEQMFMGTCKGVL
GKQDIFLERREILADQVLKEAQGLKKMREMMMDELVDNDMSSCEGKWLDYMRETYEEGIE
IEEEIVSELVDDLINDLIMCC

MEVVERKRSRGGFLNLFDWHGKSRKKLFSGSTSELSEESKQPAQNLLKSRVSLIEVDEIG
KSSSNNQRSDSSCCASSVTSDDGQGTRAPSVVARLMGLESLPVPNVQEPRLNPDLDPFLL
RPSQNTNRWDAYENLGYVNLRSDYDGISWDHLDSRTNNGRNQPIERFQSETFPPRSAKPI
CVTNNRHLSPIRSPGFVPSRNPIYVMEAASRMIEPSPRMVARTRFSPSNSPSSVPMRIQD
LREKLEAAQKVSSRQNSNDTFNLKYPSGKHNEKRITTSLTTPSTSKFMGKSSTDGLKGKV
KPSYVSAQAKAGTTPLSVTRNSANQKEKADAKKCVVKSQNALRGAPISMGKNMFKQNNQK
QNCRDNQPSMTSVLNQKSSKVNNKVVNKVPVESGSISKQLGLSTASAEKNTSLSLSRKKT
LPRSKKLPNGMQKSGISDDKRTKRSENMIKCNITIDGGLNKGKDDRKKEMDVISFTFSSP
IKGLSSDSLSSTQGIGQDTDSAVSFNIGGDSLNALLEQKLRELTSKLESSSCSLTQEEPS
YSIPMDEMNGMISFSSEYEKSTQNGLRKVLSESESVSDCTSFYDKQKFQIQAEEHEVSSI
STVTEADDLRSSCSKGFSDCRQTAEYGTIQSSSDQELTWVSLNESHQAQDESELSESVVT
LSYSEAEERLDWEFEYISEILGSDQLMVKEYALGMATDVLPASLFDEMEGRGEVTAAKIK
RKTLFDFVNKCLALRCEQMFMGSCRGLLGKGGFLFEQRDWLAEELNREIHGLKKMREMMM
DELVDKEMSSFEGRWLDFERETYEEGIDIEGEIVSTLVDDLVNDLVSGTQRRTLRQREGV
VSALVEPHLLSAF

www.000webhost.com

Other information
Ka divergence:-0.146179KaKs divergence:0.0639987
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2406Length 2 (bp):2562Length divergence:0.031
MFE 1 (kcal):-681.8MFE 2 (kcal):-763.42MFE divergence0.056