Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05810-AT5G26800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.2485904131906
Log2 mRNA fold difference:0.97053016323235
Log2 TE fold difference:0.29389074789782
Sequences
Protein sequence

MAWTRLIQSARAALGTAQSCSTLGLPRFHSSKPATYFVKVGIPEFLGGIGRGAETHIAKI
ETEIGDLHKLLVTRTLRLKKLGIPCKHRKLILKYGQKYRLGLWKPRADAIKA

MAWMRLIQSARSVLTTAPASSTLNFHRFYSKSAAPYHVKVGIPEFLSGIGGGVETHIAKL
ETELGDLPKLLVTRTLRLKKFGIPCKHRKLILKYSHKYRLGLWKPRADAIKA

www.000webhost.com

Other information
Ka divergence:0.241122KaKs divergence:-0.170326
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):339Length 2 (bp):339Length divergence:0
MFE 1 (kcal):-105.1MFE 2 (kcal):-100.2MFE divergence-0.024