Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05830-AT5G26770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.1495042336944
Log2 mRNA fold difference:0.72140994734089
Log2 TE fold difference:-0.82371077504303
Sequences
Protein sequence

MSYSEKTTVDPLLRDLDEKKESFRRNVVSLATELKQVRGRLVSQEQSFLKETITRKEAEK
RGKNMEMEICKLQKRLEERNCQLEASASAADKFIKELEEFRLKLDTTKQTAEASADSAQS
TKIQCSMLKQQLDDKTRSLREQEDRMTQLGHQLDDLQRGLSLRECSEKQLREEVRRIERE
VTEAIAKAGIGGMDSELQKLLEDVSPMKFERMNRLVEVKDEEITKLKDEIRLMSGQWKHK
TKELESQLEKQRRTDQDLKKKVLKLEFCLQEARSQTRKLQRFYCCCCFVMNGAQKGERRD
MEIKEIRDLISEKQNLNNESWDKQKFWDNSGFKIVVSMSMLMLVVVSKR

MSDSVKTTVDPLLKDLDGKKESFRRNVVSMAAELKQVRGRLVSQEQFFVKESFCRKEAEK
KAKNMEMEICKLQKKLEDRNCELVASTSAAEKFLEEVDDLRSQLALTKDIAETSAASAQS
AQLQCSVLTEQLDDKTRSLREHEDRVTHLGHQLDNLQRDLKTRECSQKQLREEVMRIERE
ITEAVAKSGKGTECELRKLLEEVSPKNFERMNMLLAVKDEEIAKLKDDVKLMSAHWKLKT
KELESQLERQRRADQELKKKVLKLEFCLQEARSQTRKLQRAGERRDKAIKELSDQITGKQ
LNESVSGEKQNFWDTSGFKIVVSMSMLILVIISKR

Other information
Ka divergence:-0.342156KaKs divergence:-0.519455
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1050Length 2 (bp):1008Length divergence:-0.02
MFE 1 (kcal):-281.98MFE 2 (kcal):-277.1MFE divergence-0.009