Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05840-AT5G26751
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):shaggy-related kinase 11

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.73607927037487
Log2 mRNA fold difference:-0.88341100355827
Log2 TE fold difference:0.11981047911494
Sequences
Protein sequence

MASVGIEPSAAVRESTGNVTDADRLPEEMKDMKIQDDKEMEATIVNGNVTETGHIIVTTI
GGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRL
LDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQ
IFRSLSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYR
APELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKC
MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFFDEL
RDPNARLPNGRFLPPLFNFKPHELKGVPVEMVAKLVPEHARKQCPWLSL

MASVGIAPNPGARDSTGVDKLPEEMNDMKIRDDKEMEATVVDGNGTETGHIIVTTIGGRN
GQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHP
NVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRA
LSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPEL
IFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPN
YTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRSAALDTLVHPFFDELRDPN
ARLPNGRFLPPLFNFKPHELKGVPLEMVAKLVPEHARKQCPWLGL

www.000webhost.com

Other information
Ka divergence:-0.276883KaKs divergence:-0.0826772
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1230Length 2 (bp):1218Length divergence:-0.005
MFE 1 (kcal):-346.91MFE 2 (kcal):-342.94MFE divergence-0.006