Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05880-AT3G05890
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Low temperature and salt responsive protein family
Function (paralog2):Low temperature and salt responsive protein family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.27759102220348
Log2 mRNA fold difference:-0.03969566138119
Log2 TE fold difference:-0.23121374339525
Sequences
Protein sequence

MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK

MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK

www.000webhost.com

Other information
Ka divergence:-0.00443184KaKs divergence:0.999722
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):165Length 2 (bp):165Length divergence:0
MFE 1 (kcal):-39.7MFE 2 (kcal):-32.29MFE divergence-0.103