Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G05910-AT5G26670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectinacetylesterase family protein
Function (paralog2):Pectinacetylesterase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6013130082813
Log2 mRNA fold difference:-2.5145409649154
Log2 TE fold difference:-0.11676040659282
Sequences
Protein sequence

MVKLLLVGFVVAGIILGTQANEYLDFNVTEIDRIEELEFGFSKYSSNLNPLMVGLTLIRG
ADSGAVCLDGTLPGYHLHRGHGSGANSWLIQLEGGGWCNNIRTCVYRKTTRRGSSNYMEK
QLQFTGILSDKAQENPDFFNWNRVKLRYCDGASFSGDGQNQAAQLQFRGERIWRAAIDDL
KANGMRYANQALLSGCSAGGLAAILRCDEFRNLFPGSTKVKCLSDAGLFLDTADVSGGRT
IRNLYNGVVELQSVKNNLPRICTNHLDPTSCFFPQNLISQMKTPLFIVNAAYDTWQIQSS
IAPTSADPSGFWHDCRLNHGKCTPAQLRFLQGFREQMLRVVKGFSMSRQNGLFINSCFAH
CQTERQDTWFADDSPVIRKKAVAIAVGDWYFDRAEVKLVDCPYPCDKSCHNLVFR

MRKLFLLGFIVAGLVLGNEANGYLEFNVTELDRIEDLEFGFSKFSSNFNPLMVGLTLIRG
AGSKGAVCLDGTLPGYHLHRGHGSGANSWLIQLEGGGWCDNIRNCVYRKKSRRGSSNYME
KQIQFTGILSNKAQENPDFFNWNRVKLRYCDGGSFSGDSQNKAARLQFRGEKIWRAAMDD
LKAKGMRNAKQALLSGCSAGGLAVILRCDEFRNLFSGWTRVKCLSDAGLFLDTPDVSGGH
TIRNLYNGVVQLQGVKNNLPHLCTNHLNPTSCFFPQNLISQMKTPLFIVNAAYDIWQIQS
SIAPPSADPSGYWHECRLNHGRCTPAQIRFLQGFRNQMLRAVSGFSNSKKNGLFINSCFA
HCQTERQDTWFADDSPVIHKKAVAIAVGDWYFDRAEVKLIDCPYPCDRSCHNLVFR

www.000webhost.com

Other information
Ka divergence:0.166667KaKs divergence:-0.188264
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1248Length 2 (bp):1251Length divergence:0.001
MFE 1 (kcal):-391.01MFE 2 (kcal):-373.3MFE divergence-0.023