Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06460-AT3G06470
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GNS1/SUR4 membrane protein family
Function (paralog2):GNS1/SUR4 membrane protein family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.8025200051697
Log2 mRNA fold difference:-1.4112921576417
Log2 TE fold difference:-0.4167898046339
Sequences
Protein sequence

MASVYSTLTYWLVHHPYIANFTWTEGETLGSTVFFVFVVVSLYLSATFLLRYTVDSLPTL
GPRILKPITAVHSLILFLLSLTMAVGCTLSLISSSDPKARLFDAVCFPLDVKPKGPLFFW
AQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYHHATVVILCYLWLRTRQSMFPVGLVLN
STVHVIMYGYYFLCAIGSRPKWKKLVTNFQMVQFAFGMGLGAAWMLPEHYFGSGCAGIWT
VYFNGVFTASLLALFYNFHSKNYEKTTTSPLYKIESFIFIHGERWANKAITLFSKKND

MASIYSSLTYWLVNHPYISNFTWIEGETLGSTVFFVSVVVSVYLSATFLLRSAIDSLPSL
SPRILKPITAVHSLILCLLSLVMAVGCTLSITSSHASSDPMARFLHAICFPVDVKPNGPL
FFWAQVFYLSKILEFGDTILIILGKSIQRLSFLHVYHHATVVVMCYLWLRTRQSMFPIAL
VTNSTVHVIMYGYYFLCAVGSRPKWKRLVTDCQIVQFVFSFGLSGWMLREHLFGSGCTGI
WGWCFNAAFNASLLALFSNFHSKNYVKKPTREDGKKSD

www.000webhost.com

Other information
Ka divergence:-0.569726KaKs divergence:-0.835045
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):897Length 2 (bp):837Length divergence:-0.035
MFE 1 (kcal):-242.95MFE 2 (kcal):-233.1MFE divergence-0.021