Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06620-AT5G49470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PAS domain-containing protein tyrosine kinase family protein
Function (paralog2):PAS domain-containing protein tyrosine kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.61550811165965
Log2 mRNA fold difference:-0.32103967758071
Log2 TE fold difference:0.031809828904353
Sequences
Protein sequence

MENPPAEELLKKILELEESQEHLKQEMSRLKVSTELRQRSHSVSPHRPARRNIGEGAPSW
RKSGAASFRNASPLRKESRIQNSMRLRSEVGGGGPSAGKFTDKQYLNILQSMAQAVHAFD
LNMRIIFWNAMAEKVYGYSAAEALGENPINVIADDRDAAFAMNIARRCVRGESWTGEFPV
KSKSGDRFSAVTTCSPFYDDDGALMGIICITSNTAPYLNPRISLAKLKAQEEGETSSIPA
RNSFASKLGLDSRGAVISKLGLDSDQPIQVAIASKISDLASKVSNKVRSKMRAGDNSATL
SEGGSGDSHQKDHNVFGATLVDHRDDAASSGASTPRGDFIQSPFGVFTCNDEKFVSKPFK
DSSDESDGKPAIHKVLTSKAEEWMVKKGLSWPWKGNEQEGSKGRPTNSVWPWVQNEQKKE
RCHQINPSAGVQYESHAFESNKPINNEASSLWSSPINANSTSSASSCGSTSSSVMNKVDT
DSEGLEYEILWDDLTIGEQVGQGSCGTVYHGLWFGSDVAVKVFSKQEYSAEVIESFKQEV
LLMKRLRHPNVLLFMGAVTSPQRLCIVSEFLPRGSLFRLLQKSTSKLDWRRRIHMALDIA
RGMNYLHHCSPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTSKSGKGTPQWMA
PEVLRNESADEKSDIYSFGVVLWELATEKIPWETLNSMQVIGAVGFMDQRLEIPKDIDPR
WISLMESCWHSDTKLRPTFQELMDKLRDLQRKYMIQFQATRAALSDNSLLKDN

MEKTTPPAEELLKKIRELEESQEHLKREMSRLKVSAEMKQRSHSASPQRPVRRNSNDGTP
MWRKTGAASFRHASPLRKESHAKVAGGGGEGQSAGKFTDKQYLNILQSMAQAVHVFDLNG
QIIFWNSMAEKLYGFSASEALGKDPIDILVDVQDASVAQNITRRCSSGESWTGEFPVKNK
AGERFSVVTTMSPSYDDDGCLIGIICITNDSALFQDPRGSPAKTRRGQEGETSFSRVTSS
VASKLGLDSKEAVVSKLGLDSQQPIQVAIASKISDLVGNKVKSKMRAGDNNAANLEGGSG
DSHQSDQGFFDAAFADRREDAATSGADTPRGDFIQSPFGVFLRSDEKASTKPFRDSSDES
DGNSVVPKTLTSKAEEWMVKKGLSWPWKGNEREGLEGRRSHSVWPWVRNEQQKQQAYQSN
SNHSVKSESQACESIKASSNEPMGYWSSSVNVNSTSSSSSCGSTSSSVMNKVDMDSDCLD
YEILWEDLTIGEQIGQGSCGTVYHGLWFGSDVAVKVFSKQEYSEEIITSFRQEVSLMKRL
RHPNVLLFMGAVTSPQRLCIVTEFLPRFGLITLANITLPFVLFELRGQNSDLPYQITFAV
EVSSVCCRGTRQNWIGGDVSIWPRIFYLAYYSLDSLIQLLYLVYNMLHIFLTYFFAQARG
MNYLHHCTPPIIHRDLKSSNLLVDKNWTVKVADFGLSRIKHETYLTTKTGRGTPQWMAPE
VLRNEAADEKSDVYSFGVILWELVTEKIPWESLNAMQVIGAVGFMNQRLEVPKNVDPQWI
SLMESCWHSEPQDRPSFQEIMEKLRELQRKYTIQFQAARAASIENSALKEK

www.000webhost.com

Other information
Ka divergence:0.0284125KaKs divergence:-0.223783
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2322Length 2 (bp):2496Length divergence:0.036
MFE 1 (kcal):-775.5MFE 2 (kcal):-771.5MFE divergence-0.003