Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06650-AT5G49460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP-citrate lyase B-1
Function (paralog2):ATP citrate lyase subunit B 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.76152954998922
Log2 mRNA fold difference:-0.563141314386
Log2 TE fold difference:-0.30883447036101
Sequences
Protein sequence

MATGQLFSRNTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGSEGFQKLFFGQEE
IAIPVHAAIEAACAAHPTADVFINFASFRSAAASSMAALKQPTIKVVAIIAEGVPESDTK
QLIAYARANNKVIIGPATVGGVQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMS
NEMYNTIARVTDGIYEGIAIGGDVFPGSTLSDHILRFNNIPQIKMVVVLGELGGRDEYSL
VEAMKQGKVTKPVVAWVSGTCARLFKSEVQFGHAGAKSGGEMESAQAKNQALQDAGATVP
TSFEALEVAIKETFDKLVEEGKVSPIKEVTPPQIPEDLSSAIKSGKVRAPTHIISTISDD
RGEEPCYAGVPMSSIIEQGYGVGDVISLLWFKRSLPRYCTKFIEICIMLCADHGPCVSGA
HNTIVTARAGKDLVSSLVSGLLTIGPRFGGAIDDAARYFKDACDRNLTPYEFVEGMKKKG
IRVPGIGHRIKSRDNRDKRVELLQKFARSNFPAVKYMEYAVQVETYTLSKANNLVLNVDG
AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP
WEDVLYTK

MATGQLFSRTTQALFYNYKQLPVQRMLDFDFLCGRETPSVAGIINPGSEGFQKLFFGQEE
IAIPVHAAIEAACAAHPTADVFINFASFRSAAASSMAALKQPTIKVVAIIAEGVPESDTK
QLIAYARANNKVVIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMS
NEMYNTVARVTDGIYEGIAIGGDVFPGSTLSDHILRFNNIPQIKMMVVLGELGGRDEYSL
VEALKEGKVNKPVVAWVSGTCARLFKSEVQFGHAGAKSGGEMESAQAKNQALIDAGAIVP
TSFEALESAIKETFEKLVEEGKVSPIKEVIPPQIPEDLNSAIKSGKVRAPTHIISTISDD
RGEEPCYAGVPMSSIIEQGYGVGDVISLLWFKRSLPRYCTKFIEICIMLCADHGPCVSGA
HNTIVTARAGKDLVSSLVSGLLTIGPRFGGAIDDAARYFKDACDRNLTPYEFVEGMKKKG
IRVPGIGHRIKSRDNRDKRVELLQKFARSNFPSVKYMEYAVTVETYTLSKANNLVLNVDG
AIGSLFLDLLAGSGMFTKQEIDEIVQIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP
WEDVLYTK

www.000webhost.com

Other information
Ka divergence:-0.22054KaKs divergence:-0.143911
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1827Length 2 (bp):1827Length divergence:0
MFE 1 (kcal):-590.72MFE 2 (kcal):-581.4MFE divergence-0.008