Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06680-AT3G06700
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Ribosomal L29e protein family
Function (paralog2):Ribosomal L29e protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.6125546472831
Log2 mRNA fold difference:3.7130498475437
Log2 TE fold difference:-0.15148379306507
Sequences
Protein sequence

MSPIFPLASLPFTQLCCAVVTEMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPK
FLRNQRYARKHNVKSGENAGVEE

MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE
E

www.000webhost.com

Other information
Ka divergence:-0.145439KaKs divergence:-0.999956
GC content 1 (%):48GC content 2 (%):53GC content divergence:0.05
Length 1 (bp):252Length 2 (bp):186Length divergence:-0.151
MFE 1 (kcal):-62MFE 2 (kcal):-44MFE divergence-0.17