Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06740-AT5G49300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GATA transcription factor 15
Function (paralog2):GATA transcription factor 16

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6038089278507
Log2 mRNA fold difference:-2.7493657768954
Log2 TE fold difference:0.25406366013381
Sequences
Protein sequence

MLDPTEKVIDSESMESKLTSVDAIEEHSSSSSNEAISNEKKSCAICGTSKTPLWRGGPAG
PKSLCNACGIRNRKKRRTLISNRSEDKKKKSHNRNPKFGDSLKQRLMELGREVMMQRSTA
ENQRRNKLGEEEQAAVLLMALSYASSVYA

MLDHSEKVLLVDSETMKTRAEDMIEQNNTSVNDKKKTCADCGTSKTPLWRGGPVGPKSLC
NACGIRNRKKRRGGTEDNKKLKKSSSGGGNRKFGESLKQSLMDLGIRKRSTVEKQRQKLG
EEEQAAVLLMALSYGSVYA

Other information
Ka divergence:0.108656KaKs divergence:-0.461249
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):450Length 2 (bp):420Length divergence:-0.034
MFE 1 (kcal):-130.4MFE 2 (kcal):-103.3MFE divergence-0.116