Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06760-AT5G49230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Drought-responsive family protein
Function (paralog2):Drought-responsive family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.049379615244397
Log2 mRNA fold difference:-0.74122369509246
Log2 TE fold difference:0.67086450151921
Sequences
Protein sequence

MDSNWINCPSVFSSSSSSSRRCQSRSDLYLGGGYEDLEGEDDLKAEFICPFCAEDFDIVG
LCCHIDEEHPVEAKNGVDQFFALVVIQCCNFWFIPCESNLGIFRLFGRSVLYALRGRRLR
RGGYSSTYLALKKELREANLQSLLGGSSSFTSSTNIDSDPLLSSFMFNSPSVNQSANKSA
TPVTVGNAATKVSIKESLKRDIQEAPLSGEDQEKAKKSEFVRGLLLSTMLEDDF

MDSNSWINCPPVFSSSPSSRRYQSRSDLYLGDVEGEDDLKAEFMCPFCADEFDIVGLCCH
IDVNHPVEAKNGVCPVCTKKVGLDIVGHITTQHGNVFKVQRRRRLRKGGYSSTYLTLKKE
LREANLQSLGGSSTFIPSSNIDSDPLLSSFMFKPPSAIPITEGDSVAQVSPKDTSKSKIQ
QESFSNEDQEKAKKSKFVRGLLWSTMLEDKF

www.000webhost.com

Other information
Ka divergence:-0.283585KaKs divergence:-0.534907
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):705Length 2 (bp):636Length divergence:-0.051
MFE 1 (kcal):-202.2MFE 2 (kcal):-173.87MFE divergence-0.075