Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06840-AT5G49170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.2609454066065
Log2 mRNA fold difference:-0.90131998145161
Log2 TE fold difference:-1.2959271671741
Sequences
Protein sequence

MSNISPIFSISNSQHFSDYGFDPQLHYFQVMEEARKHKRETSSKSYTNGLQFKIQKPISK
DNPTRSTMHNDKKKKRCWWKKALPFFKWRKWPISTVGVNEDRRVRNFRSVTGSMSMSGPI
YATESLISGSNTPYRTTTSKPSSGPIAGTLTPARKGDVAIPYLSLRELNMEQPQRISISS
SPIYLVT

MSNKSISPIFPMLQSQHFSDYGFDPQIHYFQVLEEAKKHKSSSIDTFQFKLQKPISKDDL
IRTTLHNKNKNKKRWLWCKNALFFFKWRKWPISSAVVGRCSGENDGDNEFDDRSDVHFAR
ARNFRAGSISGPVYVTESWSGSSTPYRPMTTTSAVQYLSLRELNMERQQRITTSSSMSGP
IYLVT

www.000webhost.com

Other information
Ka divergence:-0.17724KaKs divergence:0.152388
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):564Length 2 (bp):558Length divergence:-0.005
MFE 1 (kcal):-149.6MFE 2 (kcal):-162.3MFE divergence0.041